KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1243Help
Entry
lp12_1243         CDS       T01726                                 

Definition
tryptophan synthetase, alpha chain TrpA
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lpe00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:lpe00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1349938..1350756
Genome map
AA seq 272 aa AA seqDB search
MNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAE
GPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVE
AGVDGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNYINQHANGYLYYVSLK
GVTGSDALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEI
IEAYEAKKDPLQASGALLSSMRQAIDNIGSMV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattgataagactctggaaaaattaaaagccaatagaaaaaaaatgttaagt
ccttatattactgcaggcgatccatatcctgagttaacagtaagtttaatgcatcaattg
gttaaatcaggggcagatgtattggagctgggaatacccttttctgaccctatggcagaa
ggtcctgttatccaaagagcaatggaacgagctttggcgcattcaattcattgtgatgac
gtattgaatatggttaggcaatttcgcaaaacggataccgaaacgcctgtgattcttatg
ggatatttaaatcctatagaacaatatggctatgatctttttgcccagcaggcagtggag
gctggggttgatggaacaatattagttgatttgcctcctgaggaagctgatggagtatcg
cgagtttggcaaaaacatggtttgtacagtatttatttatgttcgccaaccacctcagct
gaaagaatgaactatataaatcagcatgccaatggttatctgtattatgtttcattgaag
ggagtgacaggttctgacgcgcttaagttgccagaattaaaagctcaatatctacaacga
aaggcacaatcaaaattaccgcttatggttgggtttggaataaaaactccggaaatggct
gcacaagttgctgaatttgctgatggggtcattgttggggcggcactgataaatgaaatc
attgaagcctatgaggccaagaaagatccgctgcaagcaagcggggctctattgagttcc
atgaggcaagctatcgataatattggaagtatggtatga

DBGET integrated database retrieval system