KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1352Help
Entry
lp12_1352         CDS       T01726                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    lp12_1352
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     lp12_1352
Exosome [BR:lpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lp12_1352
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1475886..1477361
Genome map
AA seq 491 aa AA seqDB search
MNYILAIDQGTSSTRAMIYTLQGDLIANSQYPLTQYYPNSGWVEHDPEEIWQKTLNAMRD
VVSQVQGKAILCCGLTNQRETTLIWNKKTGECLAPAIVWQDRRTEEFCYSLSEYSSMIQE
KTGLLPDPYFSASKLNWLLKNNAQAQSLINQGDLAFGTIDSFLIWRMTKGASHATDITNA
SRTMLFNIHDEKWDKQLLELFSISESVLPAVYSSDNHFGVIDKEWLGVEIPITGVAGDQQ
AALIGQGCFNGGMVKATFGTGGFLLLNTGDKPVFSKHKLLTTIAYKIKEKTVYGLEGSIY
HAGTTVKWLRDEMKLISHSAETEVLARSLDSNNGVYLVSSFTGLGAPHWLSITGTAIIGV
SRSTNRAHFARAALEGVCYQTRDVLTCMRDDSQLDLTLLRADGGMAVNQWFLQFMADQCQ
LTIQKPKDIETTAKGAAVLAAIGSGLFDSVSSVNKIWDVENEFQPFREREVVEKDFRGWL
EALSMVKARHA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatactagctattgaccagggaacaagtagtactcgcgctatgatctacacc
cttcaaggtgatttaatcgcaaatagtcagtatcctcttactcaatattaccccaattcg
ggttgggtagaacacgatcctgaggaaatatggcaaaaaactctgaatgcgatgagggat
gtcgtatctcaagttcaaggaaaagcaattttatgctgtggccttaccaaccaacgggaa
actactctgatttggaacaaaaaaacaggggaatgcctcgcgccagctattgtgtggcaa
gatagacgtacggaggagttttgttattccttgtctgaatactcgtcaatgatacaagag
aaaaccggattacttcctgatccctatttttcagcgagcaagttaaactggttactaaag
aataatgctcaagctcaatcactaattaaccagggggatttggcatttgggacaatagac
agttttttaatatggcgcatgactaaaggtgcaagtcatgctaccgatatcaccaacgca
tccagaactatgctgtttaatattcatgatgaaaaatgggataagcagttgctggagctt
ttttctatttcagaatcggtattaccagcggtatactccagtgataatcattttggggtg
atagataaagaatggctgggagtagaaataccaattaccggggttgcaggtgatcaacaa
gccgctttaattggacaaggttgttttaatggaggaatggttaaggctacttttggtacg
gggggatttttattactcaatacaggtgataaaccagttttctcaaagcataaattgttg
actactattgcctataaaattaaagaaaaaacagtatatggtttggagggtagtatttat
catgccggaactactgttaaatggttacgcgatgaaatgaagttgatatctcattctgct
gaaactgaagtattggctcgaagtcttgatagcaataacggcgtatatcttgtttcatct
tttactggtctgggagcacctcattggttatcaataacgggaacagccattataggtgta
tcccgttcaacgaatagagcacattttgccagggctgccttggaaggagtttgttatcaa
acacgtgatgtattaacctgtatgagagatgatagtcaattggatttgactttattaaga
gcggatggagggatggcagtaaaccaatggtttctacaatttatggctgatcagtgccag
ttgacaattcaaaaacccaaagacattgaaacgactgccaaaggggcagcagtattagcg
gcaataggttctggactatttgattcagtttcttcagtaaataagatatgggacgttgag
aacgagtttcagccattcagggaaagagaggtagttgaaaaagattttcgcggctggcta
gaggcgttgtcaatggttaaagcaaggcatgcatag

DBGET integrated database retrieval system