KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1441Help
Entry
lp12_1441         CDS       T01726                                 

Definition
(GenBank) pyruvate dehydrogenase E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00010  Glycolysis / Gluconeogenesis
lpe00020  Citrate cycle (TCA cycle)
lpe00620  Pyruvate metabolism
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01200  Carbon metabolism
Module
lpe_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_1441
   00020 Citrate cycle (TCA cycle)
    lp12_1441
   00620 Pyruvate metabolism
    lp12_1441
Enzymes [BR:lpe01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lp12_1441
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N PYNP_C HlyD_D23 HlyD_3 NQRA
Motif
Other DBs
NCBI-ProteinID: AEW51706
UniProt: G8UY09
Position
complement(1578419..1580071)
Genome map
AA seq 550 aa AA seqDB search
MSAEENMTKESEIKIPDIGGANQVDVIEILVKEGDQIEVDTPLITLESEKASMDIPSPIS
GTVTQILVKVGDKVSEGDLIVKAKSDTTTNISSSQEQKTEPEKQNLQTRAEEQSVDTKAT
ASTPSSKDIEISIPDIGGANDVDVIDILVKPGMEVEKDQALITLEGDKATMDIPSPYAGK
VIEMKIKLGDKVSQGTPILTLKTLGKSETPEIEKSQIKNISEQSIKEIEKPYEELKSEAI
SINNLEIAESKSILISAGPAVRRLAREFGVDLSLVQGSGRKSRITKEDLQNYIKVRLSEK
TTSGGFSLPSNPAIDFSKFGSIETKPLNKIKKLTGTNVHRSWITIPHVTQFDEADITDLE
AFRKSESESAKNQDYKLTLLAFVCSVVCKALHAYPQFNASLDTSGENLIYKKYYNIGIAV
DTPNGLVVPVIKNVDKLSVIDIAKEMSRLSTKAREKGLTPIDMSGGCFTISSLGGIGGTA
FTPIVNSPEVAILGLSRSIIKPIYDNKEFKPRLMLPISLSYDHRVIDGAEAARFTRFLCD
CLGDIRRVLL
NT seq 1653 nt NT seq  +upstreamnt  +downstreamnt
ctgagtgctgaggaaaatatgacaaaagaaagtgaaattaaaattcctgatatcggtggc
gctaatcaagttgatgtcattgagattttagtgaaagagggtgatcagatcgaagtagat
acaccattgattacgcttgagtctgagaaggcaagcatggacatcccttctccaatatct
ggaacggtaacgcaaattctcgttaaagtcggtgacaaagtatccgaaggtgatctcatt
gtcaaagccaagtcagatacaacgacaaatatttccagttctcaagaacaaaagactgaa
ccagaaaaacagaatttgcaaaccagagcagaagagcaatctgttgatacaaaggcaact
gcatctacacctagttccaaagatattgaaatatctatcccggatattggtggtgcaaat
gacgttgatgtaattgatattttagtcaaaccagggatggaagtagaaaaggatcaggca
ttaattacattagagggtgataaagcaacgatggatattccttcgccctatgcaggtaaa
gtcatcgaaatgaaaattaaattaggggataaagtatctcaaggtactcctattctaact
ctaaaaaccctaggaaaatctgagacacctgaaatcgaaaaaagccagattaaaaatatc
tcagaacaatctataaaggaaatagagaagccatatgaagaactaaaatccgaagcaata
tcaattaataaccttgagatagctgaatcaaaaagtatcttaatatctgcaggtccagcc
gtaagaaggttggcaagagagtttggagtcgatttatctttggttcagggaagtgggaga
aaatctcgtattacaaaagaagatctgcaaaattatatcaaagtacgtttaagtgaaaaa
actacgtctggtggcttcagcttaccgtcaaatccagccatcgatttcagtaaatttggt
tcaattgaaacaaagcctttaaataaaattaaaaaacttactggaacaaacgtacatcgc
tcctggataaccattccacatgtcactcaatttgacgaagcagatattacagacttggaa
gcgtttagaaaatcagaatcagagagcgctaaaaatcaagattacaaattaaccctgtta
gcatttgtttgcagcgtagtttgtaaggctctccatgcttacccgcaatttaatgcgtca
ctagataccagtggtgaaaatttaatttataaaaaatattataatataggtatagcagta
gatacacctaacggtctggtggttcctgtaataaagaatgttgataaattgagtgtgatt
gatattgcaaaggaaatgtccagactcagtacgaaagctagagaaaagggattaacacct
attgatatgtcaggcggttgttttacaatttccagccttggtggtataggcggaacggca
tttactcctattgtaaatagcccggaagttgcaattttgggcttatcaagatcaataata
aaacccatatacgataataaagagtttaaacccagattgatgttgcctatttcactttct
tacgatcatagagtaatcgacggcgctgaggcagcccggtttactcgctttctttgtgat
tgtttaggtgatattagaagagttttactctga

DBGET integrated database retrieval system