KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1477Help
Entry
lp12_1477         CDS       T01726                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1620664..1621089
Genome map
AA seq 141 aa AA seqDB search
MNVCYLSLGSNQKNPERQIRQAINEIKQIPSTCLIKVSRLYWNKAWGFENQQEFCNVVIE
IRTTLLPHKLLKWCQKIENRHKRVRRKFWGPRTLDIDIILYGYRLIRTKNLIVPHPCFHL
RDFVLVPLRELNSNLKIPNYT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttgctatctgagcttgggatcgaatcaaaaaaatcctgagcgtcaaataaga
caagccattaatgaaatcaaacagattccatcaacatgccttatcaaggtgtctcgctta
tattggaataaggcctggggctttgaaaatcaacaggaattttgtaatgtcgttatagag
atacgaactactctgttaccccataagctccttaagtggtgccagaaaatagaaaacagg
cacaagcgagtcaggagaaagttttgggggccaagaacattagatattgatatcatttta
tatggttatagattaattcgcacaaaaaacttaatcgttccacatccttgtttccattta
cgagattttgttcttgttcctctaagagaattaaactctaatttaaaaataccaaattac
acatag

DBGET integrated database retrieval system