KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1548Help
Entry
lp12_1548         CDS       T01726                                 

Definition
glutamate-5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp12_1548
  Amino acid metabolism
   00330 Arginine and proline metabolism
    lp12_1548
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     lp12_1548
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1693045..1694115)
Genome map
AA seq 356 aa AA seqDB search
MKIIIKVGTQSILSVDGSPIYSVLNNLVNQIIYLKNLGHQVILVSSGAVGSGRKIAKNSL
GKTYGDTVGEKQLLASIGQPELMNLYSSLFKNENILVSQLLLTKQDFHTRQHYLNIARLL
TELLKHQNIIPIVNENDSVAIEELMFTDNDELAGLIAAQINADYLILLTNVDGVFTSHPN
DPESKLINTIDPNSGWPNVSAVKSKLGRGGMVSKLDTARKMAGLGINTVIANVNVESIVP
KILNREAVGTIILASKRKSSIKRWIAFSHRTSLPSIVINDNLITLLRNGNRVMSILPIGI
EDFRGECKKGDLIDILNSNNEKIGVGIARYDFLRLKDYLRLQNKPAFIHYDQLHIL
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattattataaaagtcggaacacaaagtattttatcggtcgacggaagtccaatc
tattccgtactcaataatcttgtaaatcaaattatttatttaaagaacctggggcatcag
gtcattttagtaagctctggggctgtgggctctggtcgaaaaatagctaagaactctctg
ggaaaaacatatggcgatacagtgggagagaagcaactcttggcttcaataggccaaccc
gaactgatgaatctctattctagcttgtttaaaaatgaaaacattttagtatctcagtta
ttacttaccaaacaagacttccatactagacagcattatttaaatattgcccgtttatta
acagaattgctaaagcatcaaaatattatccctattgttaatgaaaatgattcggtagcc
attgaagaattaatgtttaccgataatgatgaattagcaggacttattgcagctcaaatt
aatgctgattatctaatactcttaaccaatgtcgatggtgtgtttacatctcatcccaat
gatcctgaatcaaaactcattaatacaattgaccccaattcaggttggcccaatgtctct
gctgtaaaatcaaaattaggccgaggtggtatggtatccaaactggatactgccagaaaa
atggctggtttaggtatcaatacagtgatcgcaaatgtaaatgtagaatccattgttcca
aaaattctaaatagggaagcagttggaaccataattcttgctagtaaaagaaaatccagt
ataaagagatggattgcttttagtcatagaacttccttaccatctatagtaattaatgat
aatttaattaccttattacgaaatggtaatcgtgtaatgagcattttaccaatagggata
gaagattttcgtggagaatgcaaaaaaggggatttaattgatatccttaattccaacaat
gaaaagataggagttggaatcgccaggtatgatttcttaagattaaaggactatcttaga
cttcaaaataagcctgcatttatacattacgatcaattgcatattctatag

DBGET integrated database retrieval system