KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1581Help
Entry
lp12_1581         CDS       T01726                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpe01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lpe00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lpe00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1733343..1734671)
Genome map
AA seq 442 aa AA seqDB search
MSLKVTYWLIIFHQKVQRLQMKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLT
IKKFYEYGNLIDFSVNLLSPFFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGP
TLSFKDLGTQFFSECLLHLIENKSAKVLVATSGDTGAAIAHALDGKRDLEGIILFPKDKL
TFRQQSQITCWGENIRALAVNGSFDQCQQLVKLVFAKREHKGILTTANSMNIARLLPQII
FYAFTSIQLALRHNHSVNFIVPGGNLGNVTACYWAKMLGFPVEQILIANNINSALGEFLL
TGAYQAKSVTKTLATAMDVGEPSNLDRLFVLFNNYSECKKQMNAESVSDEQIKQAILHCY
NKYHYIICPHTATAYHRLSTINQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKVLL
GRKQHYSIIEPNYHALYHFLVE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttgaaagtgacttactggttaataatatttcatcagaaggtgcaaaggctgcag
atgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtcttttaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagttctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttggatgggaaaagagatctggaaggaatcattttatttcctaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaattggcattaagacataatcattctgttaattttata
gttccaggcggaaacctggggaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgagcaaattttaatagctaataatattaatagtgcactgggcgaatttttgtta
actggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggaccgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccctgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagaaccactattgaaaaaagaaattcctgtcccggaacagctgaaggtcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcatgctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system