KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1581Help
Entry
lp12_1581         CDS       T01726                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lp12_1581
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lp12_1581
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lp12_1581
Enzymes [BR:lpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lp12_1581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1733343..1734671)
Genome map
AA seq 442 aa AA seqDB search
MSLKVTYWLIIFHQKVQRLQMKIRIKSTRGQCVSTIDEAILSGLAGDGGLFVPDRFPNLT
IKKFYEYGNLIDFSVNLLSPFFSDSKIDVNNAFFQKFLTFSFPLHHLFKKSYVLELFHGP
TLSFKDLGTQFFSECLLHLIENKSAKVLVATSGDTGAAIAHALDGKRDLEGIILFPKDKL
TFRQQSQITCWGENIRALAVNGSFDQCQQLVKLVFAKREHKGILTTANSMNIARLLPQII
FYAFTSIQLALRHNHSVNFIVPGGNLGNVTACYWAKMLGFPVEQILIANNINSALGEFLL
TGAYQAKSVTKTLATAMDVGEPSNLDRLFVLFNNYSECKKQMNAESVSDEQIKQAILHCY
NKYHYIICPHTATAYHRLSTINQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKVLL
GRKQHYSIIEPNYHALYHFLVE
NT seq 1329 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttgaaagtgacttactggttaataatatttcatcagaaggtgcaaaggctgcag
atgaaaattagaataaagagtacgagaggacaatgtgtctccacaatagacgaagcgata
ctgtcaggcctggcaggggatggtgggttatttgtacctgacaggtttcccaatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgttaatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgttacatcatctttttaagaaaagttatgtactggagttgtttcatggccca
accctgtcttttaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagttctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttggatgggaaaagagatctggaaggaatcattttatttcctaaagataaactt
actttcagacaacaatctcaaattacttgttggggagagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatatagccagattattaccacagattatt
ttctatgcttttaccagcattcaattggcattaagacataatcattctgttaattttata
gttccaggcggaaacctggggaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgagcaaattttaatagctaataatattaatagtgcactgggcgaatttttgtta
actggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggaccgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgagcaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgccacagcttatcatcgtctaagtaca
atcaatcaggacaaaccctgggttattgtggcaccagggcacccggccaaatttgaagag
gtattagaaccactattgaaaaaagaaattcctgtcccggaacagctgaaggtcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcatgctttgtatcatttctta
gttgaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system