KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1747Help
Entry
lp12_1747         CDS       T01726                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    lp12_1747
Enzymes [BR:lpe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     lp12_1747
Exosome [BR:lpe04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lp12_1747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1937314..1938309
Genome map
AA seq 331 aa AA seqDB search
MNEYNLPLRLSRLRKNAMSRALVRETRLHAQQLIAPLFISEYLTEPKEIGAMPGQFQLGL
NCIPEEIEILSKSGIPAVILFGIPKHKDAYGSESFNSNGIIQQAIKKIKSVNSDMLVITD
LCFCEYTDHGHCGVLNGTQINIAATLELLGKQAVSHAEAGADWVAPSGMTDGMVLAIRQA
LDHASFHEIPILSYSAKYCSCLYGPFREAAQGAPQFGDRKAYQMDPANSEEAVRETRLDL
EEGADMIMVKPAGFYLDIIYKLKQHFADVPLCAYQVSGEYSMIKNAAKNNLINEEQAMTE
SLIAIKRAGADFIISYFAKGMAELLNSQNFI
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaatataatttgcctttgaggttatctcgtttaagaaaaaatgctatgtcgaga
gcattagtaagagagaccaggctgcacgcacaacaactgattgctccattgtttattagt
gaatatttaactgaaccaaaagaaatcggcgctatgccaggccaatttcaactcggcctc
aattgtatccctgaagaaatcgaaattttatcaaaatcaggcatccctgcagtcatctta
ttcggtatccctaagcataaggatgcttatggcagtgaatcatttaatagtaatggaatc
attcaacaggctataaaaaaaataaaatctgttaatagtgacatgttagttatcaccgat
ctttgcttttgcgaatataccgatcatggtcattgcggggttctgaatgggactcaaatt
aatattgctgccactttagagttgttaggaaaacaggcggtaagtcatgctgaagcaggt
gctgactgggtagcacccagtggcatgacagacggaatggttttagctatacgccaagcc
ctggatcatgcttcatttcatgaaattcctattttaagttatagtgccaaatattgctcg
tgcctttatgggccttttagagaggcagcgcagggtgcaccacagtttggcgataggaaa
gcgtatcaaatggatccggcaaatagtgaggaagctgtaagggaaacccgattagatctg
gaagaaggcgcagatatgattatggttaaaccagccggtttttatcttgatattatttat
aaacttaaacaacattttgctgatgtaccgctttgtgcctatcaggtcagcggtgaatat
tcgatgataaaaaatgcagcaaaaaataatctaatcaatgaagaacaagcaatgactgaa
agtctcattgcgattaaacgtgctggcgctgattttattatttcttattttgctaaaggc
atggctgagttattaaactctcaaaattttatttaa

DBGET integrated database retrieval system