KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1852Help
Entry
lp12_1852         CDS       T01726                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp12_1852
   01230 Biosynthesis of amino acids
    lp12_1852
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_1852
   00030 Pentose phosphate pathway
    lp12_1852
   00051 Fructose and mannose metabolism
    lp12_1852
   00052 Galactose metabolism
    lp12_1852
  Energy metabolism
   00680 Methane metabolism
    lp12_1852
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lp12_1852
Protein phosphatases and associated proteins [BR:lpe01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lp12_1852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2052819..2054063
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPTRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQTDLDQAYALGKAAVEYAVKGYNAIMPVVIREQDEPYQWSIGQVPLAEVANQEKAM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtctggtggtgtgaccgctgtaattaatgca
tccgcttgtggtgtcatccaaaccgccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaggaattaatcgatacttcattggaa
agtgaagaagacattgccaaattgatgcaaactccttccggagcttttggctcctgccgc
tacaaattaaaagacaatggtgaagagtatcaacgcttaatcgctgtcttcaaggcccac
aacataggctatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagttaggtaaaaccatgggctatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacgaaggaagctggttttgatgtcgcgtccatggcggcttcatcgacgaaa
gtgtttattcttgaggtgatgggaaggcatgcaggctggatagctgcggctagtgggctg
gccgagcaaaatccaggcgaaccgccacacattattctattacctgaggttccttttgag
ccaactcgttttctaaaaaaagtgaaggactgtgtcaattcatatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgt
gatgcattcggacatgctcaattaggtggtgttgcacctgtcatcgctcaattaattaaa
tctgaactgggttttaaatatcattgggcagttgcagattatcttcaacgggcagccagg
cacatagcctcgcaaactgatttggatcaagcttacgctttaggtaaagctgctgtggaa
tatgccgttaaaggatataacgcgattatgcctgttgtcattcgtgagcaggacgaaccc
tatcaatggtctataggccaagtccctctggctgaggtagctaaccaggaaaaggctatg
ccgccagagtatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatccaaattacaaaaatggattgccagattatgtc
cgactaaaaaaccagttagtggctaaaaaaatcaaccaagattaa

DBGET integrated database retrieval system