KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_1951Help
Entry
lp12_1951         CDS       T01726                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lp12_1951
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     lp12_1951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2166775..2167404)
Genome map
AA seq 209 aa AA seqDB search
MVSDNSGNLYIVAAPSGGGKTSLVKKLIEMVGEIEVSVSHTTRPMRPGEKEGVDYFFIDE
KQFISMVNEGAFIEHAKVFNHWYGTSVAQINKRLQFGIDVVLDIDWQGAEQIRHAYPDAV
SVFIIPPSLDALKERLMNRRQDKDHVISERMTKAQDELGHYPEFDYLIVNDDFEKAAMEL
QSIVIANRLRIEKQVNKQAKLLSFLLSSQ
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggttagtgataattcaggaaatttatacattgttgcagcaccctccggaggagggaaa
acaagtttggtgaaaaaactcattgaaatggtgggtgagattgaagtgtcagtttctcat
acgaccagacctatgagacctggagaaaaagaaggggtggattattttttcattgatgag
aaacaatttatttctatggtgaatgagggggcgtttattgagcatgccaaagtatttaat
cattggtatggtacctcagttgctcaaattaacaaacggttacaatttggaattgacgtc
gttcttgatattgattggcaaggagcggagcaaattagacatgcctatccggatgcagtg
agtgtatttatcattcctccttctttagacgcattaaaagaacgcttgatgaacaggcga
caagataaagatcatgtgattagtgagagaatgacaaaagcacaggatgaacttggccat
tatcctgaatttgattatctgattgttaatgatgattttgaaaaggcggcaatggaatta
cagtcgatagtaattgccaataggcttcgaattgaaaaacaggtaaataaacaagccaaa
ttgctttctttcctcttgtcatcgcagtaa

DBGET integrated database retrieval system