KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2478Help
Entry
lp12_2478         CDS       T01726                                 

Definition
phosphomannomutase
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_2478
   00030 Pentose phosphate pathway
    lp12_2478
   00051 Fructose and mannose metabolism
    lp12_2478
   00052 Galactose metabolism
    lp12_2478
   00500 Starch and sucrose metabolism
    lp12_2478
   00520 Amino sugar and nucleotide sugar metabolism
    lp12_2478
  Nucleotide metabolism
   00230 Purine metabolism
    lp12_2478
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lp12_2478
Enzymes [BR:lpe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     lp12_2478
    5.4.2.8  phosphomannomutase
     lp12_2478
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2760742..2762130)
Genome map
AA seq 462 aa AA seqDB search
MTYQQKQIPRSVFRAYDIRGIIGKELDENSFYNIGLAIARYLQKLNRRQIFVARDGRLTS
HALATALKEGLLDSGIDILDLGAVATPVMYYATHTQGIDSGLMVTGSHNPADYNGIKLVL
AGKTLIQDEIDTLYALLGEVKQSAVRGTETAFDVIEGYIQRIVSDIQLKRPLKVVVDCGN
GVAGPIIPRAISKLGCEVIPLYCEVDGRFPNHHPDPSIEANLVDLKAAVANHQADIGLGF
DGDADRLGLVTNKGEVIWPDRLMMFYSREILSRNPGATVVFDVKCSSHLEKEIQAAGGVA
RMCPTGHSIVKAVMKKEQAILAGEMSGHLFFKDRWYGFDDALYSACRLLEIISFSHLTVS
EQFELIPNSVNTPEIKIAITDEEKFDFIQRFSEQADFPEGRILNIDGLRVEFPNGWGLLR
ASNTTPCLVARFEATDKDHLEQIQYLFKKQIQRLDSELDLPF
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacctatcaacaaaaacaaattccccgctctgtctttcgtgcctatgacattaggggg
attatcggtaaagaactggatgagaattctttttataacattggtttagctattgcacgt
tatttacaaaaattaaatcgtcgacaaatatttgtagctcgtgatggacgtctgaccagt
catgcattggctacggccttgaaagagggtttgctagacagtgggatagatatccttgat
cttggtgctgtggcgacacctgtcatgtattatgctacccatacgcaagggattgattct
ggattgatggttaccggaagtcataatcctgctgattataatggtatcaagttagtattg
gctggaaaaacattaattcaagatgaaatagatacactttatgctttgctgggtgaagtc
aaacagtcagctgttcgtggcacagaaacggcttttgatgtgatagaaggctacattcag
cgtatcgtgagcgatattcaattgaagcgccctttaaaagtagttgttgattgtggaaat
ggtgtggcgggtccaattattcccagggctatttcaaaattaggctgtgaagtcattccc
ctgtattgtgaagtggatggtcgatttcccaatcatcatcctgacccttcaatagaagct
aatttagttgatttaaaagcggctgtggcaaatcatcaagctgatattggtttgggcttt
gatggggatgctgacagacttggcctagtgacaaataaaggcgaagtgatttggcctgat
cgtttaatgatgttttactcacgagagattttaagtcgtaatccaggtgctactgttgtg
tttgatgtgaagtgctccagtcatttggagaaagaaatccaggcagcaggcggtgttgcc
agaatgtgccccactggccattcaattgtgaaagcggtgatgaaaaaagaacaagccatc
ttggctggcgaaatgagcgggcatctgttttttaaagatcgctggtatggatttgacgat
gctttatatagcgcatgccgattgttagagattatcagtttttcccatttgactgtcagt
gaacaatttgagttgatccctaatagtgtcaatacacctgaaataaaaatagcgattact
gatgaagaaaaatttgattttattcagcgttttagtgagcaggctgatttccctgaaggt
aggattttgaatattgatggtttgcgtgttgaatttccaaatggatggggattgttacga
gcatcaaacacaactccttgtctggtcgcacgttttgaggcgacagataaagatcatctg
gagcaaattcaatatttgtttaagaaacaaattcagcgcttggattctgagttggatttg
ccattttag

DBGET integrated database retrieval system