KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2484Help
Entry
lp12_2484         CDS       T01726                                 

Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    lp12_2484
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_2484
  Lipid metabolism
   00071 Fatty acid degradation
    lp12_2484
  Amino acid metabolism
   00350 Tyrosine metabolism
    lp12_2484
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lp12_2484
   00626 Naphthalene degradation
    lp12_2484
Enzymes [BR:lpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lp12_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2769756..2770742
Genome map
AA seq 328 aa AA seqDB search
MHAMIMEKPGCELQYQEVNKPNPNENELLIKVSACGICRTDLHVVDGELKNPKTPLIPGH
QIVGTVEQVGSAVKKFAIGQRVGVPWLGGSCGICNFCTSGRENLCDQACFTGYQIDGGFA
EFCVANYHFCFPIPDGYPDHQAAPLFCAGLIGYRALLKAGDATHLGLYGFGAAAHILIQV
ACQKGIKIYAFTSPGDQETQRFAYRLGAVWAGDSTQSPPHLLDAAIIFAPVGALVPQALS
HTVKGGTVVCAGIHMSDIPSFPYEILWGERTVCSIANLTRKDGEEFLSLAPKIPVKTKVQ
TYPLTEVNRALDDLRHGRYRGAGVIVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatgatcatggaaaagcctggatgtgaattgcaatatcaggaagtcaataaa
ccaaatccaaatgaaaatgaacttttaattaaagtatcagcttgtgggatttgtagaact
gacttgcatgttgtcgatggtgagttgaaaaatcccaagactccccttattccaggccac
caaattgtaggaactgttgagcaggttggatccgctgttaagaaatttgcaattggacag
cgagttggagtcccttggctaggtggaagttgcgggatctgtaatttttgcacctctggc
cgagaaaatttgtgtgatcaagcctgctttaccgggtatcaaatagatggtggtttcgct
gagttctgtgtagcaaattaccatttttgctttcctattcccgatggatacccggatcat
caggcagcaccattattttgtgctggtttaattggatatcgtgccttgctaaaggctggt
gacgcaactcatttaggtctatatggatttggagcggccgcacatatactgattcaagtg
gcttgccaaaaaggaataaaaatttatgcatttacaagcccaggcgatcaggaaactcaa
agatttgcataccgattaggtgctgtctgggccggggattctacgcaatcaccacctcat
cttcttgatgcagcaatcatttttgcacccgttggtgcattagtgcctcaggctcttagc
catactgtaaaaggaggtactgtggtttgtgctggtatacatatgtcggatattcccagc
ttcccttatgaaatactatggggtgaacgcactgtatgttcaattgccaatctaactcgc
aaagatggagaagagttcctgtctctagcccctaaaatcccagttaagacaaaagttcaa
acctatccccttaccgaagttaatcgagcactggatgatttaagacatggcaggtataga
ggagccggggttattgttatgaaataa

DBGET integrated database retrieval system