KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2484Help
Entry
lp12_2484         CDS       T01726                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00010  Glycolysis / Gluconeogenesis
lpe00071  Fatty acid degradation
lpe00350  Tyrosine metabolism
lpe00625  Chloroalkane and chloroalkene degradation
lpe00626  Naphthalene degradation
lpe01100  Metabolic pathways
lpe01110  Biosynthesis of secondary metabolites
lpe01120  Microbial metabolism in diverse environments
lpe01130  Biosynthesis of antibiotics
lpe01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_2484
  Lipid metabolism
   00071 Fatty acid degradation
    lp12_2484
  Amino acid metabolism
   00350 Tyrosine metabolism
    lp12_2484
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    lp12_2484
   00626 Naphthalene degradation
    lp12_2484
Enzymes [BR:lpe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     lp12_2484
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AEW52728
UniProt: G8UX66
Position
2769756..2770742
Genome map
AA seq 328 aa AA seqDB search
MHAMIMEKPGCELQYQEVNKPNPNENELLIKVSACGICRTDLHVVDGELKNPKTPLIPGH
QIVGTVEQVGSAVKKFAIGQRVGVPWLGGSCGICNFCTSGRENLCDQACFTGYQIDGGFA
EFCVANYHFCFPIPDGYPDHQAAPLFCAGLIGYRALLKAGDATHLGLYGFGAAAHILIQV
ACQKGIKIYAFTSPGDQETQRFAYRLGAVWAGDSTQSPPHLLDAAIIFAPVGALVPQALS
HTVKGGTVVCAGIHMSDIPSFPYEILWGERTVCSIANLTRKDGEEFLSLAPKIPVKTKVQ
TYPLTEVNRALDDLRHGRYRGAGVIVMK
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgcatgccatgatcatggaaaagcctggatgtgaattgcaatatcaggaagtcaataaa
ccaaatccaaatgaaaatgaacttttaattaaagtatcagcttgtgggatttgtagaact
gacttgcatgttgtcgatggtgagttgaaaaatcccaagactccccttattccaggccac
caaattgtaggaactgttgagcaggttggatccgctgttaagaaatttgcaattggacag
cgagttggagtcccttggctaggtggaagttgcgggatctgtaatttttgcacctctggc
cgagaaaatttgtgtgatcaagcctgctttaccgggtatcaaatagatggtggtttcgct
gagttctgtgtagcaaattaccatttttgctttcctattcccgatggatacccggatcat
caggcagcaccattattttgtgctggtttaattggatatcgtgccttgctaaaggctggt
gacgcaactcatttaggtctatatggatttggagcggccgcacatatactgattcaagtg
gcttgccaaaaaggaataaaaatttatgcatttacaagcccaggcgatcaggaaactcaa
agatttgcataccgattaggtgctgtctgggccggggattctacgcaatcaccacctcat
cttcttgatgcagcaatcatttttgcacccgttggtgcattagtgcctcaggctcttagc
catactgtaaaaggaggtactgtggtttgtgctggtatacatatgtcggatattcccagc
ttcccttatgaaatactatggggtgaacgcactgtatgttcaattgccaatctaactcgc
aaagatggagaagagttcctgtctctagcccctaaaatcccagttaagacaaaagttcaa
acctatccccttaccgaagttaatcgagcactggatgatttaagacatggcaggtataga
ggagccggggttattgttatgaaataa

DBGET integrated database retrieval system