KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2625Help
Entry
lp12_2625         CDS       T01726                                 

Definition
DNA polymerase III subunit chi
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lpe00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpe00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:lpe03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lpe03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpe03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2934593..2935027
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYTKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKEYRHKGCELHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctataccaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattatggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccggagcctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaagaatataggcataaaggctgtgagctgcacaca
cactccattgaataa

DBGET integrated database retrieval system