KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2625Help
Entry
lp12_2625         CDS       T01726                                 

Definition
(GenBank) DNA polymerase III, chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
lpe00230  Purine metabolism
lpe00240  Pyrimidine metabolism
lpe01100  Metabolic pathways
lpe03030  DNA replication
lpe03430  Mismatch repair
lpe03440  Homologous recombination
Module
lpe_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lp12_2625
   00240 Pyrimidine metabolism
    lp12_2625
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    lp12_2625
   03430 Mismatch repair
    lp12_2625
   03440 Homologous recombination
    lp12_2625
Enzymes [BR:lpe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     lp12_2625
DNA replication proteins [BR:lpe03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     lp12_2625
DNA repair and recombination proteins [BR:lpe03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     lp12_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: AEW52867
UniProt: G8UYT9
Position
2934593..2935027
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYTKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKEYRHKGCELHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctataccaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattatggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccggagcctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaagaatataggcataaaggctgtgagctgcacaca
cactccattgaataa

DBGET integrated database retrieval system