KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2747Help
Entry
lp12_2747         CDS       T01726                                 

Definition
recombinational DNA repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lp12_2747
DNA repair and recombination proteins [BR:lpe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lp12_2747
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3066108..3066707
Genome map
AA seq 199 aa AA seqDB search
MTMDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCN
NYTEQTLCALCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDD
IGLPKLKELITREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELE
FLDGNTISSALKNRAVINV
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ctgactatggatgctctaagccgattggtagaggcgcttcgctgtcttcccggtgtggga
ccaaaatcagcacaaaggatggtgttccatttattgcagcaccaaaggcagcgaggttta
caccttgcctcctgtttagaacaggcaatgaagcacattagtcattgtcagcagtgtaat
aattacaccgaacaaacactgtgtgctctttgtcaaaatcctaatcgagattcgacattg
ctttgtgtggtagagagtccagcagatgtttctgccatagaacaaagcaattcctttcaa
ggtaagtattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgac
ataggtctaccgaaacttaaggagttaattactagggaaaaaattcaggaagttattctt
gcattaagccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaag
gatgaaaccgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaa
tttttagatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system