KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2757Help
Entry
lp12_2757         CDS       T01726                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lp12_2757
Enzymes [BR:lpe01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     lp12_2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3076710..3077276
Genome map
AA seq 188 aa AA seqDB search
MAARLGILAMEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGAL
FDSDMSEMVIVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQI
QERLTGEIAHCIESTTGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCR
LEFLNLIR
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
ttggccgccaggttaggaattcttgctatggaaaaattatactcaaatttgcttaaagaa
ttaggcgaagatataaatcgggaaggattaaaggatactcctggacgagcagctaatgcc
ttacgttatttaactaaaggttacaatgagaaccttgatgaaatcattaacggtgctctg
tttgattcagacatgagtgaaatggttatcgtcaaggacatagaactgtactcattatgc
gaacatcacttattgccttttttgggtaaatgccatgttggatatctacctgatggtaaa
gtaataggcttatctaaaattgctcgtattgttgatttttatgcgaggagactacaaatt
caagaacggctgacgggcgaaattgctcactgtattgaatccactaccggagctcgcggt
gtcgccgtagtgattgaagcaaaacatctttgcatgatgatgcgtggagttgaaaaacaa
aattctgtcatgacaacttcagttatgctcggtgaaatgcgtaacaattcgagctgccgt
ttggaattcttaaatttaattcgttaa

DBGET integrated database retrieval system