KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2783Help
Entry
lp12_2783         CDS       T01726                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lp12_2783
   01230 Biosynthesis of amino acids
    lp12_2783
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lp12_2783
   00051 Fructose and mannose metabolism
    lp12_2783
   00562 Inositol phosphate metabolism
    lp12_2783
Enzymes [BR:lpe01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lp12_2783
Exosome [BR:lpe04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lp12_2783
  Exosomal proteins of bladder cancer cells
   lp12_2783
  Exosomal proteins of melanoma cells
   lp12_2783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3102741..3103490)
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNGQIQQVTELVSQIEELIGFDCAAQVAVMPPSIYIPKVRDCLRTGKIV
VGAQNVYPKDYGAYTGELSAPMLKDFDCRYVLVGHSERRQFFHEDENFVAQKFHHVKDHG
MIPVLCVGETLSERENGKTEQVIAQQVLAVSAKGKDCFRDCVVAYEPVWAIGTGKTATPE
QAQKIHQFIRDLVGEINDSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaaaagatagttgctggtaactggaaaatgaatggccagattcaacaggtgact
gaattggtttcgcaaattgaggaattaattggctttgattgcgcagcacaggttgctgta
atgcctcccagcatttatatacccaaggtaagagactgcttaaggacggggaagattgta
gtaggtgcgcaaaatgtttatccgaaagattatggtgcctacacaggtgaactgtcagct
cccatgcttaaagattttgattgccgatatgttctggtaggacactcggagcgcaggcaa
ttttttcatgaagatgaaaattttgtggcgcaaaaattccaccatgtcaaagatcatggt
atgatacctgttctttgtgttggtgaaactctttctgaaagagagaatggaaaaacagag
caggttattgctcaacaggtgctcgcagtgagtgcaaaagggaaagattgttttcgtgat
tgcgtagtggcttatgagcctgtatgggcaattgggacaggaaaaactgctacacctgaa
caggcacaaaaaatacaccagtttattagagatctggttggagaaataaatgatagcgat
gcgaaacatttgacgctcatatatggtggcagtgttaatgaaaataatgcaaaagcctta
ttttccatgccagatattgatggagggttagtgggtggagcatcgttgaatgcaaaacaa
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system