KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2786Help
Entry
lp12_2786         CDS       T01726                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpe00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3108689..3109564)
Genome map
AA seq 291 aa AA seqDB search
MNSEQFLGWLERKSQPPSSLVFEKPLIMGVLNVTSDSFYDGGKYLSVDSACDQALKLIAC
GADLIDIGGESTKPGAPPVPLDVELSRVLPVIKQLRVLADVCISIDTNKPEVMEAAIDAG
ANVINDVYALRRDGALNVAAQLDVPVCLMHMKGEPRTMQENPSYPEGIMKELQHFFKERI
DKCQKAGLNKNKLILDPGFGFGKRVKDNLKLIYHLNELRSFGLPILLGVSRKSTIGAVLN
NEVEQRLIGSITLGIYAALKGTAIIRTHDVDETNQALTMINAIYQAAKEIG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaattctgaacagttcctcggttggcttgagcgaaagagccaacctccttcctccttg
gtttttgaaaagccattaattatgggtgtgttaaatgttacctcggactcattttatgat
ggtggcaagtatctgtctgttgatagcgcctgtgatcaggccttaaaattaattgcatgt
ggagctgatctcattgatattggtggggaatcaaccaaacctggtgctcccccagtccct
ttagatgttgaactatcaagagttcttcccgtaatcaaacaacttcgtgtcctcgcagat
gtgtgtatttctattgatactaataagccagaggtgatggaagcggcaatcgatgctggt
gcgaatgttataaatgatgtttatgctttaagaagggatggtgctctgaatgttgctgcg
cagttagatgttcctgtttgtttaatgcacatgaaaggagagccgcgaactatgcaagaa
aatccttcttacccagaaggaataatgaaggaattacagcatttttttaaagagcgcatc
gataaatgccagaaagctgggctgaataagaataaattaattcttgaccctggctttggt
tttggaaagcgcgttaaagataacctaaaattaatttatcatctgaacgaattgcgttct
tttggattgccaattcttttgggcgtttcacgcaaaagcacaattggtgctgtattgaat
aatgaagttgagcaacgtttgattggaagtattacgctaggaatatatgctgctcttaaa
ggcactgcaattatcaggacacatgatgtggatgaaacgaatcaagcattaactatgatt
aatgcaatttatcaagctgctaaagaaatcggttaa

DBGET integrated database retrieval system