KEGG   Legionella pneumophila subsp. pneumophila ATCC 43290: lp12_2786Help
Entry
lp12_2786         CDS       T01726                                 

Definition
7,8-dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lpe  Legionella pneumophila subsp. pneumophila ATCC 43290
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lp12_2786
Enzymes [BR:lpe01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lp12_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3108689..3109564)
Genome map
AA seq 291 aa AA seqDB search
MNSEQFLGWLERKSQPPSSLVFEKPLIMGVLNVTSDSFYDGGKYLSVDSACDQALKLIAC
GADLIDIGGESTKPGAPPVPLDVELSRVLPVIKQLRVLADVCISIDTNKPEVMEAAIDAG
ANVINDVYALRRDGALNVAAQLDVPVCLMHMKGEPRTMQENPSYPEGIMKELQHFFKERI
DKCQKAGLNKNKLILDPGFGFGKRVKDNLKLIYHLNELRSFGLPILLGVSRKSTIGAVLN
NEVEQRLIGSITLGIYAALKGTAIIRTHDVDETNQALTMINAIYQAAKEIG
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
gtgaattctgaacagttcctcggttggcttgagcgaaagagccaacctccttcctccttg
gtttttgaaaagccattaattatgggtgtgttaaatgttacctcggactcattttatgat
ggtggcaagtatctgtctgttgatagcgcctgtgatcaggccttaaaattaattgcatgt
ggagctgatctcattgatattggtggggaatcaaccaaacctggtgctcccccagtccct
ttagatgttgaactatcaagagttcttcccgtaatcaaacaacttcgtgtcctcgcagat
gtgtgtatttctattgatactaataagccagaggtgatggaagcggcaatcgatgctggt
gcgaatgttataaatgatgtttatgctttaagaagggatggtgctctgaatgttgctgcg
cagttagatgttcctgtttgtttaatgcacatgaaaggagagccgcgaactatgcaagaa
aatccttcttacccagaaggaataatgaaggaattacagcatttttttaaagagcgcatc
gataaatgccagaaagctgggctgaataagaataaattaattcttgaccctggctttggt
tttggaaagcgcgttaaagataacctaaaattaatttatcatctgaacgaattgcgttct
tttggattgccaattcttttgggcgtttcacgcaaaagcacaattggtgctgtattgaat
aatgaagttgagcaacgtttgattggaagtattacgctaggaatatatgctgctcttaaa
ggcactgcaattatcaggacacatgatgtggatgaaacgaatcaagcattaactatgatt
aatgcaatttatcaagctgctaaagaaatcggttaa

DBGET integrated database retrieval system