KEGG   Legionella pneumophila Lens: lpl0303Help
Entry
lpl0303           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf01040  Biosynthesis of unsaturated fatty acids
lpf01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    lpl0303
Enzymes [BR:lpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     lpl0303
Lipid biosynthesis proteins [BR:lpf01004]
 Desaturase
  First
   lpl0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase DDE_Tnp_ISL3
Motif
Other DBs
NCBI-ProteinID: CAH14534
Pasteur: lpl0303
UniProt: Q5WZS8
Position
complement(345834..346988)
Genome map
AA seq 384 aa AA seqDB search
MMFGFLNMTLWGYLLTGFVLTHITTTAVTIYLHRYQTHRALTLHPLVSHFFRFWLWLTTG
MTTAEWVAIHRKHHANTDMEGDPHSPQVFNIRKVFWQVPELYREASKDKDMIKKYSYGTP
NDWIERKLYSPHANKGIFLMLALNLFLFGIPGLTLWAIQMMWIPLVAGVVNGIGHYWGYR
NHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEFDLGWFYIRCLSFLKLAK
VKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIFPTLRDMQYRIKNRDLKNA
RHLLKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQIWLKTSLSNKDLLNLIQKW
CSQAEESGLLVLRQFASQLKSYSL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttggttttttaaatatgactttatggggatatcttttgaccggttttgtcctg
actcacatcaccactactgctgttaccatttacctgcatcgctaccagacacaccgcgca
ttaactctgcatcctcttgtcagccattttttccgtttctggctttggttaacgacaggg
atgaccacagcagaatgggtagccattcataggaaacatcatgccaatactgacatggaa
ggggatccgcatagccctcaggtatttaatataagaaaagtattttggcaggttccagag
ttatatcgagaagcatctaaagataaagacatgattaaaaagtactcctatggtaccccc
aacgactggatagagcgcaaattatactctccccatgcgaacaaaggcatatttttaatg
ctcgcacttaatcttttcttgtttggaattcctggacttaccctttgggcaatccaaatg
atgtggatacctcttgttgctggcgtggtcaatggaatagggcattattggggttatcgc
aatcatgaatcgtcagattcttcaaccaatgtttttccctggggtttattgattgctggt
gaagaattgcataataatcatcataccttcgcctcctcagccaaattttccattaaatgg
tgggaatttgatttgggttggttttacatacgttgtttgtcttttttaaagcttgccaaa
gtaaaaaaattacccccaaaactgatcattgacaagaataaatctcatatagatgtagat
tcggtaaaagctatacttggcaatcgctttcaagtgatatctgattattacaagctggtt
atatttcctactctgcgcgatatgcaataccgcataaaaaatcgggatttaaagaatgct
cgccatttacttaagaaaccgaatgaacagctatcccatgctgatcagttgcgattgaaa
acattacttaagcaacatgacaacttgcaagcggttcataattaccgcgaattattacag
cagatatggttaaaaacgtccctatccaataaggatcttcttaatttaatacaaaaatgg
tgtagccaggccgaagaatccggactgcttgtgttaaggcaatttgcatcacaattaaaa
agctattctctctga

DBGET integrated database retrieval system