KEGG   Legionella pneumophila Lens: lpl0303Help
Entry
lpl0303           CDS       T00208                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lpf  Legionella pneumophila Lens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    lpl0303
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    lpl0303
Enzymes [BR:lpf01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     lpl0303
Lipid biosynthesis proteins [BR:lpf01004]
 Desaturase
  First
   lpl0303
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(345834..346988)
Genome map
AA seq 384 aa AA seqDB search
MMFGFLNMTLWGYLLTGFVLTHITTTAVTIYLHRYQTHRALTLHPLVSHFFRFWLWLTTG
MTTAEWVAIHRKHHANTDMEGDPHSPQVFNIRKVFWQVPELYREASKDKDMIKKYSYGTP
NDWIERKLYSPHANKGIFLMLALNLFLFGIPGLTLWAIQMMWIPLVAGVVNGIGHYWGYR
NHESSDSSTNVFPWGLLIAGEELHNNHHTFASSAKFSIKWWEFDLGWFYIRCLSFLKLAK
VKKLPPKLIIDKNKSHIDVDSVKAILGNRFQVISDYYKLVIFPTLRDMQYRIKNRDLKNA
RHLLKKPNEQLSHADQLRLKTLLKQHDNLQAVHNYRELLQQIWLKTSLSNKDLLNLIQKW
CSQAEESGLLVLRQFASQLKSYSL
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttggttttttaaatatgactttatggggatatcttttgaccggttttgtcctg
actcacatcaccactactgctgttaccatttacctgcatcgctaccagacacaccgcgca
ttaactctgcatcctcttgtcagccattttttccgtttctggctttggttaacgacaggg
atgaccacagcagaatgggtagccattcataggaaacatcatgccaatactgacatggaa
ggggatccgcatagccctcaggtatttaatataagaaaagtattttggcaggttccagag
ttatatcgagaagcatctaaagataaagacatgattaaaaagtactcctatggtaccccc
aacgactggatagagcgcaaattatactctccccatgcgaacaaaggcatatttttaatg
ctcgcacttaatcttttcttgtttggaattcctggacttaccctttgggcaatccaaatg
atgtggatacctcttgttgctggcgtggtcaatggaatagggcattattggggttatcgc
aatcatgaatcgtcagattcttcaaccaatgtttttccctggggtttattgattgctggt
gaagaattgcataataatcatcataccttcgcctcctcagccaaattttccattaaatgg
tgggaatttgatttgggttggttttacatacgttgtttgtcttttttaaagcttgccaaa
gtaaaaaaattacccccaaaactgatcattgacaagaataaatctcatatagatgtagat
tcggtaaaagctatacttggcaatcgctttcaagtgatatctgattattacaagctggtt
atatttcctactctgcgcgatatgcaataccgcataaaaaatcgggatttaaagaatgct
cgccatttacttaagaaaccgaatgaacagctatcccatgctgatcagttgcgattgaaa
acattacttaagcaacatgacaacttgcaagcggttcataattaccgcgaattattacag
cagatatggttaaaaacgtccctatccaataaggatcttcttaatttaatacaaaaatgg
tgtagccaggccgaagaatccggactgcttgtgttaaggcaatttgcatcacaattaaaa
agctattctctctga

DBGET integrated database retrieval system