KEGG   Legionella pneumophila Lens: lpl0323Help
Entry
lpl0323           CDS       T00208                                 

Gene name
pncA
Definition
nicotinamidase/pyrazinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
lpf  Legionella pneumophila Lens
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    lpl0323 (pncA)
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     lpl0323 (pncA)
    3.5.1.-  
     lpl0323 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
368964..369584
Genome map
AA seq 206 aa AA seqDB search
MKTLIILDVQNDFMRGGSLGVPNGDAIVPVINSILHCFDLIVASQDWHPSNHISFASNHT
GRKPFEKIKLGNLEQILWPDHCVQGSIGAQFHAQLNTNPIEAIFRKGTDPNIDSYSGFYD
NLHKKTTGLAGYLREKGARELYFCGLCADICVYFTIKDALSQGFDCYLIEDATQALVKDD
FIKIKKELIKQGSHIINSSNLLNNLQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagactttaatcatcctcgatgttcaaaatgatttcatgcgaggcggctcactggga
gtgccgaatggtgatgcgattgttcctgttattaacagcattttgcattgttttgatctg
attgttgcttcacaggattggcatccctctaatcatatcagtttcgcctccaatcatact
ggcaggaaaccttttgaaaaaatcaagctggggaatttagaacaaattttatggccagat
cattgtgttcagggtagtattggagcgcaatttcatgcgcaattaaatactaatcctatt
gaagctatttttcgaaaaggaactgaccccaatatagatagctacagtggtttttatgat
aatttgcataaaaaaaccacagggcttgccggttatctgcgcgaaaaaggcgctagagaa
ctttatttttgtggtttgtgcgctgatatttgtgtttattttacaattaaggatgctctc
agtcagggatttgattgctatttgattgaggatgcaactcaagcgcttgtgaaagatgat
ttcataaaaataaaaaaagaattgataaaacagggctctcacataattaacagttcaaat
ttgcttaataatttacaataa

DBGET integrated database retrieval system