KEGG   Legionella pneumophila Lens: lpl0353Help
Entry
lpl0353           CDS       T00208                                 

Gene name
folA
Definition
(GenBank) dihydrofolate reductase FolA
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00670  One carbon pool by folate
lpf00790  Folate biosynthesis
lpf01100  Metabolic pathways
Module
lpf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpl0353 (folA)
   00670 One carbon pool by folate
    lpl0353 (folA)
Enzymes [BR:lpf01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     lpl0353 (folA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1
Motif
Other DBs
NCBI-ProteinID: CAH14584
Pasteur: lpl0353
UniProt: Q5WZM8
Position
407488..407979
Genome map
AA seq 163 aa AA seqDB search
MSLISLIAAIDETGGLGINNQLLCYLPADLQHFKSITMGKPIIMGRKTYESIGKPLPGRL
NVVISQSIQSIPGVVVVDSLGQAIKETADASEVMIIGGAKIYSQAISMANRLYITRIHHQ
FTADVFFPKINELAWCCRSKEYRQHDDKNQYDMTFCVYERISI
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgtctctgattagcctgatagcagccatagatgaaacaggaggattgggtattaacaac
caattactctgctatttgccagctgacttacagcattttaaatcgattaccatgggtaag
cctattatcatgggcagaaaaacttatgaatcgataggcaaacctcttccaggtagacta
aacgtcgtgattagtcaatcgattcagtcaataccgggtgttgttgttgtcgattctttg
ggccaggccataaaagaaaccgctgacgcatcagaggtaatgatcattggaggagccaag
atctattctcaagccatatcaatggctaatcgcttatatattactcgaatacaccatcaa
tttacggccgatgtattttttccaaaaatcaatgaattggcatggtgctgtcgaagcaag
gagtatcgacagcatgatgacaaaaatcaatacgatatgacgttttgcgtatatgaaaga
atatcaatttga

DBGET integrated database retrieval system