KEGG   Legionella pneumophila Lens: lpl0462Help
Entry
lpl0462           CDS       T00208                                 

Gene name
glk
Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpl0462 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl0462 (glk)
   00052 Galactose metabolism
    lpl0462 (glk)
   00500 Starch and sucrose metabolism
    lpl0462 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    lpl0462 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    lpl0462 (glk)
   00524 Butirosin and neomycin biosynthesis
    lpl0462 (glk)
Enzymes [BR:lpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     lpl0462 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
506046..507053
Genome map
AA seq 335 aa AA seqDB search
MNFFMMPHDLAQYAIVADIGGTFARFSRVNLVNLQMDKIEVSPCAEFISLESALLTYKNR
HSLQEIKHIAIAIACPVIDDLVSMTNCHWQFSITELKQRLGLEVLEVMNDFTAIAMSLPV
LSTQDLVQIGNGYLDASKVKVVLGAGTGLGVAYLIPHQHHYSAFAGEGGHADWGAKTEQE
WFIYRYLKSKYSHVSYERLLSGQGLENLYQALAAYHSKKVEFLSAAQIISLALNQECFIA
HKAVAQFFSSLGSFAGDLALTYGAFGGVYIAGGIMPRLLSLVHQSDFRIQFEDKGRFSDF
NALIPTYVIAASQPGILGASVSLKQILTGASHVHF
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttttatgatgcctcatgatttagcgcagtatgctattgttgcggacataggc
ggtacttttgctcgtttcagtagagttaatcttgtcaatttgcagatggataaaattgaa
gtttctccttgtgccgagtttattagtcttgagtccgcgctattaacttataaaaaccgg
cattctttacaagaaataaaacatattgcaatagcgattgcgtgtccggtcatcgatgat
ttggtttctatgacgaattgtcattggcaattttcaataacagagttaaaacagagactt
ggccttgaagttctggaagtcatgaatgattttactgcgattgcgatgagtttacctgta
ttatcgactcaggatctggtgcagattggtaatggttacctggatgccagtaaagtgaaa
gtggtgttaggcgcagggaccggtttgggtgttgcttatttaattcctcatcaacatcac
tatagtgcttttgcaggggaaggggggcatgctgattggggagcaaaaactgagcaggaa
tggtttatctatcgttatttaaaaagtaaatactcccatgtatcttatgagcgcttgctg
tctggccaaggactggaaaatttatatcaagctttagccgcgtatcatagtaaaaaagtt
gaatttttgtcagcagcgcaaattatatctttagcattaaatcaggaatgtttcatagct
cataaggcagtagcccaatttttttcaagtttgggatcgtttgctggtgatttagcatta
acttatggagcttttggtggtgtttatattgcaggagggattatgccgcgtttgctctcc
ttggtacaccaaagcgactttagaatccaatttgaagacaaaggacgatttagtgatttt
aatgccttaattcccacttatgtcattgcagcctctcaaccaggtattttaggcgcgagc
gtcagtttaaaacaaatattgacaggagcttctcatgtccatttctga

DBGET integrated database retrieval system