KEGG   Legionella pneumophila Lens: lpl0465Help
Entry
lpl0465           CDS       T00208                                 

Definition
hypothetical protein
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
lpf  Legionella pneumophila Lens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    lpl0465
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     lpl0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(509327..510634)
Genome map
AA seq 435 aa AA seqDB search
MLKRIFFLMIFFVSQTMASVFTHEEVQILKKHFLNNFQTNGAIVASPSQYNPNYYYDWIR
DSAIAMGLVETWYEASQSARYKKLLLEYVSWTEKIQHQADPIAGQDILGEPKFYINGNPF
DGEWGRPQNDGPALRASVLIRFAQRLLVQNEIDYVKSHLYNNTMDPQSMGTIKMDLEYIA
HHWQDANFDLWEEVYGHHFFTAMAQQKALTDGAILAHQLHDRQAAVFYEMQANLINSRLQ
QHLDHQNKIIQATLLPHPGPQKTLELDSSVMLGILTNPQKEGVFAPHHTFVRNTAKALHE
QFNLMFPINKNRSGAILFGRYPGDTYDGYQTNSIGNPWFILTATMAEYYFTMAHNLSPNS
SNKLHIQNYLKKGDNYLRLIKQYGPDLNLSEQINLNTGVQQGATSLTWSYVSVLRAIHLR
EQLENRIKTMGWNTY
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaggatctttttcttaatgattttttttgtctctcaaactatggcttcagta
tttacccatgaagaggttcaaatattaaaaaaacattttttaaataactttcaaaccaat
ggagccatcgtagcctctccctcccaatacaaccccaattattattatgactggattcga
gactcagccattgccatgggattggttgagacatggtatgaagccagccaatctgctcga
tataaaaaacttttattagaatacgtttcatggacagaaaaaatacagcatcaagcggat
cccattgctggccaggatatattgggtgaacccaaattttatatcaatggcaatcctttt
gatggggaatggggacgaccacaaaatgatggtccggcactcagagcatctgttttaatt
cgttttgcgcaacggcttctcgtacagaatgaaatagattatgttaaatcacatctttat
aacaacaccatggacccacaatccatgggcactatcaagatggatttggaatacatcgca
catcattggcaagatgcaaattttgacctgtgggaagaggtttatggccatcattttttc
acggctatggcacaacaaaaagcgctgaccgatggcgccattttggctcaccaacttcat
gacagacaagctgctgttttttatgaaatgcaagccaacttaattaacagtcgactgcaa
cagcatttggaccatcagaataaaataattcaagccacattattacctcaccccggtcct
caaaaaaccctagagcttgattcgtccgtcatgttgggtattttaactaacccacaaaaa
gaaggtgtttttgccccacatcacacctttgtgcgaaatactgcaaaggctttgcatgag
caatttaatttgatgtttcctattaataaaaaccgttctggagcaatattgtttggtcgt
tatcccggcgatacttatgatggttaccaaacaaacagcatagggaacccctggtttatc
ttaacagctacgatggccgaatattattttaccatggctcataatctgtccccgaacagc
agtaataaacttcatatacagaactatctaaagaaaggggacaattacctaaggctgata
aaacaatatggccctgatctgaatttaagtgaacaaattaatttgaataccggagttcag
caaggagcgacatccttgacctggagttacgtttccgtcttgcgagctattcatttaaga
gaacaattggaaaatagaataaaaaccatgggctggaatacctattag

DBGET integrated database retrieval system