KEGG   Legionella pneumophila Lens: lpl0575Help
Entry
lpl0575           CDS       T00208                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00020  Citrate cycle (TCA cycle)
lpf00190  Oxidative phosphorylation
lpf00650  Butanoate metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Module
lpf_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lpf_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lpf_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    lpl0575 (sdhD)
   00650 Butanoate metabolism
    lpl0575 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    lpl0575 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: CAH14806
Pasteur: lpl0575
UniProt: Q5WZ09
Position
621003..621350
Genome map
AA seq 115 aa AA seqDB search
MVNNVTSLTGNGLKDWLIQRVTAVYFAAYLIFLFGFILANPDLNFSQWHLLFANKVFQIA
TTIGLIALTLHAWIGIWTVTTDYMKCTVIRLSVQLLVVLWLFGQFIWGLMIIWGQ
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaacaatgtcaccagcttaacaggaaatgggttaaaggattggttaattcaaaga
gttacagctgtctattttgcagcctatttaatttttttatttggatttatattggcaaat
cctgacttaaatttttctcaatggcatcttttgtttgccaataaggtatttcaaattgca
acaacaattgggttgatagctttaacattgcatgcctggataggtatttggacagtaact
acagattatatgaaatgtactgtgatacgtttatcagtacagttattggttgttttatgg
ctctttggtcaatttatctggggccttatgatcatttggggacaatag

DBGET integrated database retrieval system