KEGG   Legionella pneumophila Lens: lpl0612Help
Entry
lpl0612           CDS       T00208                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
lpf  Legionella pneumophila Lens
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpf00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:lpf00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
665033..666556
Genome map
AA seq 507 aa AA seqDB search
MLSKYELIKPDIGSSHGNITKVYEIVGGKPLRGQVKVSGSKNAALPVLAASLLCKEPLQL
TNLPKILDVTNMIQCMEALGKRFEFINTNTIKIGNREMDTLTIPKEAARQIRASIILLGP
LVAQYPKVILPLPGGCSIGKRPIDLHISALNALGVDIVELPDCLVCSRRYARLQGNTINF
SIKTVTGTENAMMAAVLAEGTTIINNAAMEPEIVDLANFLNRLGAKINGGGSDRITISGV
DKLNSCGSYSIMADRIEAGTYLVAAAMTRGSISVKGVNPDYLVAVLSELKCAGAKITCDS
DSIQLDMGEEYGESLNITTKPYPGFPTDLQSLFLSLTCVLRGNSYLCETLFEDRFQIVQE
LKKMGANISLKDNTAHIKGVSRLRGSQVNATDLRSGAALVCASLAAEGITQIFAIEHIER
GYEDLILKLKALGANIKLIENTHVTSTELSDSHFKEATSSETRIQRASLIETIVTPSITT
FGQFKRVPTGEVTELEKQQTPYLHHIM
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcaaatatgagctaattaaacctgacataggatccagtcacggcaatatcaca
aaagtgtatgaaatagtcggcggcaaaccgctcagagggcaagtcaaagtaagcgggtct
aaaaatgctgctctgcctgtactggcagcgagtttattatgcaaagagccgctgcagtta
accaatttaccgaaaatattagatgttaccaatatgattcaatgcatggaagcattaggt
aaaagatttgaatttatcaatactaacacgattaaaattggcaatagagaaatggataca
ctgactattccaaaggaggcagccagacaaattcgtgcttcaattattttattaggccct
ttggttgcgcagtatccaaaggtgatattgccattaccaggtggatgctctattgggaaa
cgtcccattgatttgcacatcagtgcgcttaatgcgttgggtgtagatattgttgagcta
ccagattgtttagtatgttctcgccgttatgctcggcttcaaggaaatactattaacttt
tccatcaagactgtgactggaacagaaaatgcgatgatggcggctgtattggcagaagga
acaactattataaataatgctgcaatggaacccgagatagttgatttggctaatttttta
aataggcttggagcaaaaattaatggggggggtagcgacagaatcacaatttccggtgta
gataaattaaattcttgtggaagttattccatcatggcagatagaatcgaggctggtact
tatttagtagcagcagcgatgactcgcggttctatttccgttaaaggagtcaatccggat
tatctggttgcagttttgagcgaattaaaatgtgcaggtgcaaaaattacctgtgattct
gactcaatccagcttgatatgggagaagagtatggtgaatcgttaaatataaccacaaaa
ccctatccaggctttccaacagatctgcaatctctctttttaagtctgacttgtgtttta
aggggtaactcttatttgtgtgagactctatttgaagatcgttttcaaatagtccaagag
cttaaaaaaatgggagccaatatttctttaaaggataacactgcccacataaagggtgtt
tcaagattaaggggttctcaagtcaatgctactgatttacgctcaggtgccgctttagta
tgtgccagtttggcagcggagggtatcacgcagatttttgccatagagcatatagagcgc
ggttatgaagatttaatattaaaattaaaagcacttggcgccaatattaaattaattgag
aatacccatgtaacaagcacggaattatctgacagtcatttcaaagaggcgactagtagt
gaaactcgaatacaacgagcatcgttgattgaaaccatagtaacaccatctataacaaca
tttggacagtttaaaagagtacctacaggagaagtgacggaattggaaaaacagcagaca
ccttatctgcatcacattatgtaa

DBGET integrated database retrieval system