KEGG   Legionella pneumophila Lens: lpl0622Help
Entry
lpl0622           CDS       T00208                                 

Gene name
pyrB
Definition
(GenBank) hypothetical protein
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00240  Pyrimidine metabolism
lpf00250  Alanine, aspartate and glutamate metabolism
lpf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    lpl0622 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    lpl0622 (pyrB)
Enzymes [BR:lpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     lpl0622 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace Hydrolase DUF3271 Sigma70_r1_1
Motif
Other DBs
NCBI-ProteinID: CAH14855
Pasteur: lpl0622
UniProt: Q5WYW3
Position
674741..675634
Genome map
AA seq 297 aa AA seqDB search
MKHFIEISQLSSEQIESLLQRALYFKHTKQYPSYSQSIIANLFYENSTRTRISFELAERH
LAMSVVNLDLETSSETKGEAIEDTIRTLAAMGIQYFVIRHKQDGLQQNLANKLGDTVHII
NAGDGTHAHPSQAILDMVTIVEQKKQLDKLKIAILGNIKHSRVANSFQCICSKLGVGELV
LISPEIWQPSQVHFGRVTDNLNEGLEGADVVICLRVQKERLLQDDHLDLDFYRNNFALTQ
KSLSYAKPDAMVMHPGPMNRGVEIDSEVADGNQSCILQQVTNGVYARMAILESLIAS
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagcattttattgaaattagtcaattgtcatctgaacaaattgaatccttattgcaa
cgagctttatactttaaacacacaaaacaatacccttcttattcccaaagtattattgct
aatttattttatgaaaacagtaccagaacccggatcagttttgagttagcagagcgccat
ctggcaatgtctgtagtgaatctggatcttgagacctcatcagaaactaaaggcgaagcc
attgaagacaccatcagaacgctagccgctatgggtatccagtattttgtaattcgccat
aagcaagatgggctgcagcaaaatttagctaataagttaggtgatacagttcatataata
aatgctggtgatggaactcatgcacatccaagccaggcgatattggatatggtgacaatt
gttgaacaaaaaaagcaattagacaaattaaaaattgctattttgggaaatatcaaacat
tcacgtgttgctaattctttccaatgcatttgcagtaaattaggggttggtgagttggtt
ttgatttctccggagatttggcaaccatcacaagtgcactttggacgggttactgataat
ctcaatgaaggtctggaaggtgcggatgtagtaatttgcctgcgagttcaaaaggaacgt
ttgctgcaagatgatcatttggatttggatttttatagaaacaattttgcacttactcaa
aaaagtctgtcttatgcaaaacctgacgctatggttatgcaccctgggcctatgaatcgc
ggggttgaaattgatagtgaagtggctgatggcaaccaatcttgtattttacaacaggtt
actaatggtgtttatgcaagaatggctatccttgaatcgctgatagcgagttag

DBGET integrated database retrieval system