KEGG   Legionella pneumophila Lens: lpl0737Help
Entry
lpl0737           CDS       T00208                                 

Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpf  Legionella pneumophila Lens
Brite
Enzymes [BR:lpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     lpl0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(837788..838438)
Genome map
AA seq 216 aa AA seqDB search
MNHSARINMIKQQLRTGDVLNESILDLYDEILRHEFVPELFSNFAYSDMQIPLAHGQRML
TPLEEGTIIQALDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSDFTANAKRKLEE
NNCNNVELITGDACRGWLESAPYDVMVFTGAMEKLTDTHKLQILPGGKLFAILGKSPVMQ
AYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacagtgcacgcataaatatgatcaaacaacagttacgaactggtgatgtatta
aatgaatccatcctcgacttatacgatgagattttacgacatgagtttgttccagagctt
ttctctaattttgcttattcagacatgcaaattcccttggcacatggccaaaggatgtta
actccattggaagaaggaacaattatacaagcccttgatcttaaaggccatgaaaccgtg
ctggaagtaggaacaggaaccggttttatgactgctttactcagtaaattatgtaaaaaa
gtaatcagtattgactattattctgactttactgccaatgcaaaacgtaaacttgaagag
aataattgtaataatgttgaattaatcaccggagatgcttgtcgtggatggttggaaagt
gccccatacgatgttatggtatttactggtgccatggaaaaactgacagatacccataaa
ctacaaattttacccggtggcaagttgtttgcgatccttggtaaatcccctgtaatgcaa
gcttatctttttcagttggatcataatgcaatctggacagaatccatgctttttgaaacg
gatatacctcctctggtagatcaattgaaaccgaaagaatttgttttctag

DBGET integrated database retrieval system