KEGG   Legionella pneumophila Lens: lpl0737Help
Entry
lpl0737           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
lpf  Legionella pneumophila Lens
Brite
Enzymes [BR:lpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     lpl0737
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 RrnaAD Methyltransf_31 Methyltransf_11 Methyltransf_12 NodS MTS Ubie_methyltran Methyltransf_4 Methyltransf_23 Methyltransf_18 Methyltransf_PK PrmA GCD14 Methyltransf_2 Methyltransf_32 CMAS Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: CAH14971
Pasteur: lpl0737
UniProt: Q5WYJ9
Position
complement(837788..838438)
Genome map
AA seq 216 aa AA seqDB search
MNHSARINMIKQQLRTGDVLNESILDLYDEILRHEFVPELFSNFAYSDMQIPLAHGQRML
TPLEEGTIIQALDLKGHETVLEVGTGTGFMTALLSKLCKKVISIDYYSDFTANAKRKLEE
NNCNNVELITGDACRGWLESAPYDVMVFTGAMEKLTDTHKLQILPGGKLFAILGKSPVMQ
AYLFQLDHNAIWTESMLFETDIPPLVDQLKPKEFVF
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaatcacagtgcacgcataaatatgatcaaacaacagttacgaactggtgatgtatta
aatgaatccatcctcgacttatacgatgagattttacgacatgagtttgttccagagctt
ttctctaattttgcttattcagacatgcaaattcccttggcacatggccaaaggatgtta
actccattggaagaaggaacaattatacaagcccttgatcttaaaggccatgaaaccgtg
ctggaagtaggaacaggaaccggttttatgactgctttactcagtaaattatgtaaaaaa
gtaatcagtattgactattattctgactttactgccaatgcaaaacgtaaacttgaagag
aataattgtaataatgttgaattaatcaccggagatgcttgtcgtggatggttggaaagt
gccccatacgatgttatggtatttactggtgccatggaaaaactgacagatacccataaa
ctacaaattttacccggtggcaagttgtttgcgatccttggtaaatcccctgtaatgcaa
gcttatctttttcagttggatcataatgcaatctggacagaatccatgctttttgaaacg
gatatacctcctctggtagatcaattgaaaccgaaagaatttgttttctag

DBGET integrated database retrieval system