KEGG   Legionella pneumophila Lens: lpl0864Help
Entry
lpl0864           CDS       T00208                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthases
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00400  Phenylalanine, tyrosine and tryptophan biosynthesis
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01130  Biosynthesis of antibiotics
lpf01230  Biosynthesis of amino acids
Module
lpf_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpl0864 (trpC)
Enzymes [BR:lpf01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     lpl0864 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C HTH_5
Motif
Other DBs
NCBI-ProteinID: CAH15098
Pasteur: lpl0864
UniProt: Q5WY75
Position
complement(982089..982865)
Genome map
AA seq 258 aa AA seqDB search
MNSILERIAKHKLEEVAVAKKNKPLHVLSKQQPGEIRDFITALKSNTSPAVIAEIKKASP
SKGLIRKDFNVAEIAKIYTQNGARCLSVLTDIEFFQGHPDYLALAKSKTTLPVLRKDFII
DSYQIYESLVLGADCILLIVALLDDVQLMDFCQLAQELKMSVLVESHTQDELERALRLPT
PLIGINNRSLHNFKTDIQLSIQLKQFVPKDKIIITESGINTREDIKLMQSHDINAFLIGE
SLMRADNIGKALQKLMTD
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgaatagtatcctggaacgaatagccaaacataaactagaagaagttgcagttgcgaaa
aaaaataagcctttacatgttctgtcaaaacaacagccgggggaaatacgtgactttata
actgctttaaaatccaatacctcacctgcagtcatagccgagataaaaaaggcttctcca
agcaaaggtttaattcgaaaagattttaatgttgcagaaattgccaaaatttatacccaa
aatggcgcaagatgcttatccgttttaacggatattgagttttttcaaggtcatcctgat
tatttggctttagcaaaatcaaaaactactttgcccgtattacgtaaagactttattatt
gattcttatcaaatttatgaaagccttgtcttgggcgctgattgcattttactgattgtc
gcattattagatgatgttcaattaatggatttttgccaactggctcaagaacttaaaatg
tctgttttggttgaaagccacacgcaagatgagttagaaagagcattacgcttacccacc
cctcttataggcattaataaccgcagcctacacaactttaaaacagacattcaactgagt
atccaattaaaacaatttgttcctaaagataaaattattattactgaaagcggaatcaac
acccgtgaagacataaaattaatgcaatcccatgacattaatgcctttttgattggagag
agtttaatgagggcagataacatcgggaaagcattacagaaactaatgactgactaa

DBGET integrated database retrieval system