KEGG   Legionella pneumophila Lens: lpl0918Help
Entry
lpl0918           CDS       T00208                                 

Gene name
dapE
Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lpf  Legionella pneumophila Lens
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpl0918 (dapE)
  Amino acid metabolism
   00300 Lysine biosynthesis
    lpl0918 (dapE)
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     lpl0918 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1029978..1031111)
Genome map
AA seq 377 aa AA seqDB search
MTDITQILTDLIGFPSITPEDAGCQKYMIQFLEQLGFTCQQLNNGPVSNFFACYGKIGPL
LVFAGHTDVVPVGEVSKWDTDPFSLEEKNGMLYGRGVADMKGSLACMLHMARRFIKTYPS
FPGRLGFLITSGEEGDEFNLGTPYAMQKLEQQGIVIDYCIVGEPSSSLKTGDVIKIGRRG
SLSAKIHLSGKQGHVAYPHLADNPIHRISPVLAELTSMQWDNGNAYFPPTSMQITYIHCG
GHAGNIIPGELNLHLNFRYSTEQTDESLKTRVINAFTHHKLNPTIEWRLNGEPFLTNKGI
LLESCKQTVLEHIGTLPELSTSGGTSDGRFIAPYGVEVIELGLVNATIHQVNECTSLQDL
NTLETMYFSICEKLLID
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactgatattacgcaaattctgactgacctcattggctttccttctattacaccagaa
gatgctggctgccaaaaatacatgattcaatttctggagcaattgggatttacttgtcaa
caactgaataatgggcccgtatccaatttttttgcctgctatggcaaaattgggccttta
ttggtgttcgcaggccataccgatgtagttcctgttggtgaagtatcaaaatgggataca
gaccctttctctctcgaagaaaaaaatggcatgctctatggtcgtggggttgctgatatg
aaaggcagcctggcctgtatgttacatatggccagaagatttattaaaacttatccttcc
tttccaggcagactaggatttctgatcaccagcggcgaagaaggcgatgaatttaatttg
ggcaccccttatgcgatgcaaaaactggagcaacaagggattgttattgattattgcata
gtaggtgaaccttcaagcagcttgaaaactggtgatgtcatcaaaattggaagacgtgga
tcattaagtgccaaaatacatctgagtggaaagcaaggtcatgttgcctatccgcatttg
gctgacaatccaattcatagaattagcccagtattagccgagctcacttcaatgcaatgg
gataatggcaatgcttattttcctcctacctccatgcaaataacttatatccattgtgga
gggcatgcgggtaatattatcccaggcgaattaaatctgcatttgaactttagatattcg
acagagcaaacagacgagtcattaaaaacgagagtaattaatgcctttacacaccataaa
cttaaccccactatagaatggcgattaaatggcgaaccattcttaacgaataaaggcata
ttgctagaaagctgcaaacaaacagtgcttgaacatattgggactctccccgaactttca
acaagtggtggaacttcagatgggcgttttatagcaccttatggggttgaggtcatagag
ctgggactggtaaatgcaaccattcatcaggttaatgaatgcacttctctacaggatttg
aatacacttgaaaccatgtatttctcaatctgtgagaaattattaattgattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system