KEGG   Legionella pneumophila Lens: lpl0948Help
Entry
lpl0948           CDS       T00208                                 

Gene name
murE
Definition
hypothetical protein
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
lpf  Legionella pneumophila Lens
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    lpl0948 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lpl0948 (murE)
Enzymes [BR:lpf01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     lpl0948 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1059810..1061261
Genome map
AA seq 483 aa AA seqDB search
MKLTQLLEPWIKRDIIDGTVSDIKNDSRLVKEGDLFAAYPGAASDGRLYIEKAVASGAAA
VVYEPNNLPQGITLPTAIPCIAIPQLAEKLGEIAKRFFNNPSQFLGLTGVTGTNGKTTIA
YQLAQAHDLLGQHSAYIGTIGQGKVDALKPLENTTPDALCLQRLMHQYKEEGIKQVCMEV
SSHALSQHRVDSLEFSQAIFTNLTLDHLDYHQTMQAYGAAKSRLFERSELQWAIINQDDD
CQDLMSNVLKTHVKKVTYGMHQNCDVKAIQWNMDITGTEIEVKSPWGHHLLKIKALGKFN
IYNSLAVYSSLLASGYNPEKVVQIMAELKAAPGRMEIVAQSPYVLVDYAHTPDALENVLI
TLKQIKKGRLWVVFGCGGDRDKTKRPIMGKAASMYADNIVITSDNPRSEDPEIILNEIAC
GMPASAPVSKLVNREEAIAYALRKAEHNDIILIAGKGHESYQQIGNTKHVFSDQEVVRRL
MNN
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
gtgaaactaacccaattattagaaccgtggattaaaagggacattattgatggcactgtt
agtgacataaaaaatgacagtcgcttggtgaaagagggggatttatttgcagcctatcca
ggggcagcttccgatggtcgattatatatagaaaaggctgtggcatcaggtgctgccgct
gtggtttatgagcctaataatttacctcagggaattactttgccaacagcgattccctgc
atagctattccccaattagctgaaaaactaggagaaatagcgaaacggttttttaataac
ccatcccaatttcttggtttaactggggtaactggcacaaatggcaagacgactattgct
tatcagttggcacaggcacatgatttactcgggcagcactcggcttacattgggaccata
gggcaaggcaaggtggatgccttaaaacctttggaaaatactacgccagatgctctttgt
ttgcagaggttgatgcatcagtataaagaagagggcattaaacaggtttgtatggaggta
tcctctcatgcattgagccagcatagagtcgactctctcgaatttagtcaggctatcttt
accaatttaacgctcgatcatttagattatcaccagacaatgcaagcttatggggctgca
aagtcgaggttgtttgaacgttcggagttgcaatgggctattattaatcaggatgacgac
tgtcaagatctcatgagcaatgtgctaaagactcatgtaaaaaaagtgacttacggtatg
catcaaaattgcgatgtgaaagcgatccaatggaatatggatatcaccggaacagaaatt
gaagtcaaatctccttgggggcaccaccttctaaagattaaagcactgggtaagtttaat
atttataatagcctggctgtttatagcagtctgcttgccagcgggtataatccagaaaaa
gtagtgcaaattatggctgaattaaaagcggctcctggccgaatggaaattgtcgctcaa
tccccatatgttcttgttgattatgctcatactcccgatgcattggaaaatgttcttatc
accttaaaacaaataaaaaaagggagattgtgggttgtatttggttgtggtggggacaga
gataaaaccaaacggcccattatgggaaaggcagccagcatgtacgctgataatattgtc
attaccagcgataatccaagaagtgaagatccggaaattattctaaatgaaattgcttgt
ggcatgcctgcctctgcgcctgtttctaaactggtgaatagagaagaagcaattgcttat
gctttaagaaaggctgaacataacgatatcatattaatagcaggaaaaggacatgaatcg
tatcagcagattgggaatacaaaacatgttttttctgatcaggaagttgtaagacgtttg
atgaataattaa

DBGET integrated database retrieval system