KEGG   Legionella pneumophila Lens: lpl1199Help
Entry
lpl1199           CDS       T00208                                 

Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lpf  Legionella pneumophila Lens
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lpf00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lpf00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1342201..1343349
Genome map
AA seq 382 aa AA seqDB search
MSLALKIKSIILSFFLCLMATVACATQVGLRDKIGQMLILGFQGKVVDEKSPIAQAIEKN
NIGGVILFDFNQQSQTFNKNIENPEQVNRLNNQLQTLTQKANRKYHRDNLPLLISVDYEG
GNVNRLHPRYGFPEMPSAKDIGSMSLERADASAELMANTLKSTGFNLNFFPELDVNINPD
NPIIGKKDRSFSSIPEIVTQYAQLYTEQFITHQIHCSYKHFPGHGSSLSDSHLGFVDITD
TWSEQELIPFLQLLSQPNHCDMVMIAHIVNRKLDMTGLPASLSYQIINGLLRRDLKFDGV
VITDDMQMKAITNYYGLETAVTLSINAGADMLIFGNQLVEKFQDSTEIIDMIEQKVRSGE
ISEQRINEAYQRIVKMKRSFNY
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagtttagcattgaaaatcaagtcaattattttatctttttttctttgtttgatggca
acagtagcttgtgccacacaagtgggtttgagagataaaattgggcaaatgttaatatta
gggttccagggcaaagtggttgacgagaaatcacctattgcccaggcaattgagaaaaac
aacattggtggtgttattctttttgattttaatcagcagtcacaaacttttaataaaaat
atagaaaatccggaacaagttaaccggttaaataatcagttacaaacacttacgcaaaaa
gccaatcgtaaatatcatagagataatttaccattacttatttctgtcgattacgaaggt
ggaaacgtcaatcgattgcatccccgttatggattccctgaaatgccttcagcaaaagac
attggctccatgtctctggaaagagctgatgcatcagcagaattgatggcaaatacttta
aaatcaacaggatttaatttgaattttttccctgaattagatgtgaatataaaccctgat
aatcctatcataggcaaaaaagacaggagtttctcttcgataccggaaattgtcactcaa
tacgcgcaactttatacagagcaatttataacacatcaaatacattgttcttataaacat
tttcctggacatggcagttcattatctgattcacatttgggttttgtagatataactgac
acctggagcgagcaagaattaatcccttttttacaattattatctcaacccaatcattgc
gatatggtgatgatagctcatattgtgaatagaaaactggatatgacagggctacctgcc
agcctttcttaccagatcattaacggattattgcgtcgtgatttaaaatttgacggggtt
gttatcaccgatgatatgcaaatgaaagcaataacgaattattatggattagaaactgct
gttactctttcgattaatgcaggagcagatatgctaatatttggtaatcaattggtagaa
aaatttcaagactcgacagaaatcattgacatgatcgagcaaaaagttcgatcgggtgag
atttctgaacaaaggattaatgaagcttatcaacgaattgtaaaaatgaagaggtctttt
aattattag

DBGET integrated database retrieval system