KEGG   Legionella pneumophila Lens: lpl1251Help
Entry
lpl1251           CDS       T00208                                 

Gene name
ruvA
Definition
(GenBank) holliday junction DNA helicase
  KO
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lpf  Legionella pneumophila Lens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpl1251 (ruvA)
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     lpl1251 (ruvA)
DNA repair and recombination proteins [BR:lpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     lpl1251 (ruvA)
    RecFOR pathway proteins
     lpl1251 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1393893..1394492
Genome map
AA seq 199 aa AA seqDB search
MIGWLHGQIIDKHQPGKLVLDVNGVGYDVETSLNTFFQIENGNQPIGLHIHTIVREDALL
LYGFLDKEERSLFRSLIKVNGVGPKLAMTVLSSISPKEFIQCIHQENAALLTKLPGIGKK
TAERLVVEMRDSIKQFDGSVSDTFQKQAGSTHSQQEAISALEALGYKPQEAWKVVNKIDN
GNKSCEQLIREALQILSSR
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgataggctggctccatggtcaaattatagataagcatcagccaggaaaattggttctt
gatgtcaatggcgtaggatatgatgtagaaacatctttgaatactttttttcagatagaa
aatggtaaccaacctatcggattacatattcacaccatagttcgagaagatgctttgtta
ttgtatggcttcctggataaagaggagcgttctttattcagatcattaattaaagtgaat
ggggtaggccccaaactggctatgactgttttatccagtatttctcctaaagaatttatt
cagtgtattcaccaggagaatgctgctttattaaccaaattacctggcataggcaagaaa
actgcagagcgcttagtagttgaaatgagagacagtataaagcaatttgatggttcggtt
tccgataccttccaaaagcaggcaggtagcactcatagtcaacaagaggcaatcagcgcg
ttggaggcattgggctataagccacaagaggcgtggaaagttgtgaataaaattgataat
ggcaataagagttgtgagcaattgattcgtgaggctttgcaaattctttcttcgcgatga

DBGET integrated database retrieval system