KEGG   Legionella pneumophila Lens: lpl1267Help
Entry
lpl1267           CDS       T00208                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpl1267 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpl1267 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpl1267 (trpB)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpl1267 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1409201..1410400
Genome map
AA seq 399 aa AA seqDB search
MIKKELPDEFGHFGPYGGMFVADTLVHALKQLEHAYTKYRNDQDFLSELHTELKDYVGRP
NPLYHAVHLSKKIGGAQIYLKREDLNHTGAHKINNTIGQALLAKRMGKTRVIAETGAGQH
GVATATVAAKFGFQCVVYMGSEDIKRQSSNVYRMKLLGAEVVPVTSGSKTLKDALNEALR
DWVSHVDDTFYIIGTVAGPHPYPQMVRDFQAIIGVEARAQHMEKTGRLPDALVACVGGGS
NAIGLFYPFLNDQSVMIYGVEAGGKGIETGEHSASLIAGKPGVLHGNRTYLLCDEYGQVK
DTHSVSAGLDYPGVGPEHAYLKDTGRVIYKAINDSEALDAFRLLTHTEGIIPALESSHAV
AYAIQLAKTMSKEQSIIVNLSGRGDKDMHTVAAIDGITI
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaaaagagcttccagatgagtttggccattttggcccatatggcggtatgttt
gtagccgatacattagttcatgctttaaaacaattagagcatgcctacaccaaatatcgt
aacgatcaggattttctgtctgagttacacacagaattaaaagattatgtggggcggccc
aatcctctataccatgctgtacacttaagtaaaaagataggcggtgcacaaatttatctc
aagcgtgaagatttaaatcataccggcgctcataaaatcaataataccattggacaagcc
ttactcgccaaacgcatggggaaaactcgagtgatcgcggaaacaggcgcaggtcaacat
ggcgttgcaactgctacagttgccgctaaatttggatttcaatgcgttgtgtacatgggg
tcagaagacattaagcgtcaatccagtaatgtttatagaatgaaattgttaggtgctgaa
gtggtgcctgtcacttcaggatcaaagacgttgaaagatgctttaaatgaagcattgaga
gattgggtgagtcatgtcgacgacacgttttatattattggtactgttgcaggtccccat
ccttatcctcaaatggtaagagatttccaagcgattattggtgttgaagctcgagctcag
catatggaaaaaacaggccgtttgccagatgctttggtagcttgtgtcggaggtggatcc
aatgcaataggcttgttttatccctttttgaatgatcagtctgtcatgatttatggggtt
gaagcaggagggaaaggcatagaaaccggtgagcattcggcatctctgattgctggaaaa
cctggcgtgttacacggtaacaggacctatttattgtgtgatgagtatggacaggtgaaa
gacactcattcagtatcagccggtctggattatcctggagttgggcctgaacatgcttat
ttaaaagatactggacgggttatttataaagcaataaatgattctgaggccctggatgcg
tttcgcctgttaactcatacagaaggaattattccagcattagaatctagccacgcggta
gcctatgccatacaattggctaaaaccatgtcaaaagaacaaagcattatagtcaatcta
tctggtcgtggtgataaagatatgcatacagtagctgctattgacggtataacaatttaa

DBGET integrated database retrieval system