KEGG   Legionella pneumophila Lens: lpl1268Help
Entry
lpl1268           CDS       T00208                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpl1268 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpl1268 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    lpl1268 (trpA)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     lpl1268 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Structure
PDB: 

Jmol
Position
1410426..1411244
Genome map
AA seq 272 aa AA seqDB search
MNRIDKTLEKLKANRKKMLSPYITAGDPYPELTVSLMHQLVKSGADVLELGIPFSDPMAE
GPVIQRAMERALAHSIHCDDVLNMVRQFRKTDTETPVILMGYLNPIEQYGYDLFAQQAVE
AGVDGTILVDLPPEEADGVSRVWQKHGLYSIYLCSPTTSAERMNFINQHANGYLYYVSLK
GVTGSDALKLPELKAQYLQRKAQSKLPLMVGFGIKTPEMAAQVAEFADGVIVGAALINEI
IEAYEAKKDPLQASGALLSSMRQAIDNIGSMV
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgtattgataagactctggaaaaattaaaagccaatagaaaaaaaatgttaagt
ccttatattactgcaggcgatccatatcctgagttaacagtaagtttaatgcatcaattg
gttaaatcaggggcagatgtattggagctgggaatacccttttctgaccctatggcagaa
ggtcctgttatccaaagagcaatggaaagagctttggcgcattcaattcattgtgatgac
gtattgaatatggttaggcaatttcgcaaaacggataccgaaacgcctgtgattcttatg
ggatatttaaatcctatagaacaatatggctatgatctttttgctcaacaggcagtggag
gctggggttgatggaacaatattagttgatttgcctcctgaggaagctgatggagtatcg
cgagtttggcaaaaacatggtttgtacagtatttatttatgttcgccaaccacctcagct
gaaagaatgaactttataaatcagcatgccaatggttatctgtattatgtttcattgaag
ggagtgacaggttctgacgcgcttaagttgccagaattaaaagctcaatatctacaacga
aaggcacaatcaaaattaccgcttatggttgggtttggaataaaaactccggaaatggct
gcacaagttgctgaatttgctgatggggtcattgttggtgcggcactgataaatgaaatc
attgaagcctatgaggccaagaaagatccgctgcaagcaagcggggctctattgagttcc
atgaggcaagctatcgataatattggaagtatggtatga

DBGET integrated database retrieval system