KEGG   Legionella pneumophila Lens: lpl1365Help
Entry
lpl1365           CDS       T00208                                 

Gene name
glpK
Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    lpl1365 (glpK)
Enzymes [BR:lpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     lpl1365 (glpK)
Exosome [BR:lpf04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   lpl1365 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1521301..1522776
Genome map
AA seq 491 aa AA seqDB search
MNYILAIDQGTSSTRAMIYTLQGDLIANSQYPLTQYYPNSGWVEHDPEEIWQKTLNAMRD
VVSQVQGKAILCCGLTNQRETTLIWNKKTGECLAPAIVWQDRRTEEFCYSLSEYSSMIQE
KTGLLPDPYFSASKLNWLLKNNAQAQSLINQGDLAFGTIDSFLIWRMTKGASHATDITNA
SRTMLFNIHDEKWDKQLLELFSISESVLPAVFSSDNHFGMIDKEWLGVEIPITGVAGDQQ
AALIGQGCFNGGMVKATFGTGGFLLLNTGDKPVFSKHKLLTTIAYKIKEKTVYGLEGSIY
HAGTTVKWLRDEMKLISHSAETEVLARSLDSNNGVYLVSSFTGLGAPHWLSITGTAIIGV
SRSTNRAHFARAALEGVCYQTRDVLTCMRDDSQLDLTLLRADGGMAVNQWFLQFMADQCQ
LTIQKPKDIETTAKGAAVLAAIGSGLFDSVSSVNKVWDIENEFQPFREREVVEKDFRGWL
EALAMVKARHA
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgaactatatactagccattgaccagggaacaagtagtactcgcgctatgatctacacc
cttcaaggcgatttaatcgcaaatagtcagtatcctcttactcaatattaccccaattcg
ggttgggtagaacacgatcctgaggaaatatggcaaaaaactctgaatgcgatgagggat
gttgtatctcaagttcaaggaaaagcaattttatgctgtggccttaccaaccaacgggaa
actactctgatttggaacaaaaaaacaggggaatgcctcgcgccagctattgtgtggcaa
gatagacgtacggaggagttttgttattccttgtctgaatactcgtcaatgatacaagag
aaaaccggattacttcctgatccctatttttcagcgagcaagttaaactggttactaaag
aataatgctcaagctcaatctctaattaaccagggggatttggcatttggaacaatagac
agttttttaatatggcgcatgactaaaggtgcaagtcatgctaccgatatcaccaacgca
tccagaactatgctgtttaatatccatgatgaaaaatgggataagcagttgctggagctt
ttttctatttcagaatcggtattaccagcggtattctccagtgataatcattttgggatg
atagataaagaatggctgggagtagaaataccaattaccggggttgcaggtgatcaacaa
gccgctttaattgggcaaggttgttttaatggaggaatggttaaagctacttttggtacg
gggggatttttattacttaatacaggtgataaaccagttttctcaaagcataaattgttg
actactattgcctataaaattaaagaaaaaacagtatatggtttggagggtagtatttat
catgccggaactactgttaaatggttacgcgatgaaatgaagttgatatctcattctgct
gaaactgaagtattggctcgaagtcttgatagcaataacggcgtatatcttgtttcatct
tttactggcctgggagcacctcattggttatcaataacaggaacagctattataggtgta
tcccgttcgacgaatagagcacattttgccagagccgccttggaaggagtttgttatcaa
acacgtgatgtattaacctgtatgagagatgatagtcaattggatttgactttattaaga
gcggatggagggatggcagtaaaccaatggtttctacaatttatggctgatcagtgccag
ttgacaattcaaaaacccaaagacattgaaacgactgccaaaggggcagcagtattagcc
gcaataggttctggactatttgattcagtttcttcagtaaataaggtatgggacattgag
aacgagtttcagccattcagggaaagagaggtagttgaaaaagattttcgtggctggcta
gaggcgttggcaatggttaaagcaaggcatgcatag

DBGET integrated database retrieval system