KEGG   Legionella pneumophila Lens: lpl1383Help
Entry
lpl1383           CDS       T00208                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lpf01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lpf00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:lpf00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
1543426..1544694
Genome map
AA seq 422 aa AA seqDB search
MKIRIKSTRGQCISTIDEAILSGLAGDGGLFVPDRFPDLTIKKFYEYGNLIDFSAHLLSP
FFSDSKIDVNNAFFQKFLTFSFPLHYLFKKSYVLELFHGPTLSFKDLGTQFFSECLLHLI
ENKSAKVLVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRALAV
NGSFDQCQQLVKLVFAKREHKGILTTANSMNIVRLLPQIIFYAFTSIQLALRHNHSVNFI
VPGGNLGNVTACYWAKMLGFPVEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMDVG
EPSNLERLFVLFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRLST
INQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKILLGRKQHYSIIEPNYHSLYHFL
VE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattagaataaagagtacgagaggacaatgtatctccacaatagacgaagcaata
ctgtcaggcttggcaggggatggcgggttatttgtaccggacaggttccccgatttaaca
ataaaaaaattttatgaatacggtaatttaatcgacttttctgctcatttactctcgcca
tttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctcaccttc
tcctttccgctgcattatctttttaagaaaagttatgtactcgagttgtttcatgggcca
accctgtctttcaaagatttaggaactcaatttttcagtgaatgtttattgcatctgata
gaaaacaagagcgccaaagtcctggtcgcaacatctggtgatactggcgctgcgattgct
catgctttgcatgggaaaagagatctggaaggaatcattttatttcccaaagataaactt
actttcagacaacaatctcaaattacttgttggggggagaatattcgtgcattggctgtt
aatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaagagaacat
aaaggaatattgactacagccaatagcatgaatattgtcagattattaccacagattatt
ttttatgcttttaccagcattcaactggcattaagacataatcattctgttaattttata
gttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctgggtttt
ccggttgaacaaattttaatagctaataatactaatagtgcactgggcgaatttttatta
acgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggatgtaggt
gagccaagcaatttggagcgcttattcgttttatttaataattattctgaatgtaaaaaa
cagatgaatgcagaatctgttagtgatgaacaaattaagcaagctatcctacattgttac
aataaatatcattatataatttgccctcataccgctacagcttatcatcgtctaagtaca
atcaatcaggataaaccctgggttattgtggcaccagggcacccggcgaaatttgaagag
gtattagaaccactattgaaaaaagaaatccctgtcccggaacagctgaagatcctttta
ggcagaaaacaacattattcaatcatagagccaaactatcattctttgtatcatttctta
gttgaatga

DBGET integrated database retrieval system