KEGG   Legionella pneumophila Lens: lpl1383Help
Entry
lpl1383           CDS       T00208                                 

Gene name
thrC
Definition
(GenBank) hypothetical protein
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    lpl1383 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    lpl1383 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    lpl1383 (thrC)
Enzymes [BR:lpf01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     lpl1383 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
1543420..1544694
Genome map
AA seq 424 aa AA seqDB search
MQMKIRIKSTRGQCISTIDEAILSGLAGDGGLFVPDRFPDLTIKKFYEYGNLIDFSAHLL
SPFFSDSKIDVNNAFFQKFLTFSFPLHYLFKKSYVLELFHGPTLSFKDLGTQFFSECLLH
LIENKSAKVLVATSGDTGAAIAHALHGKRDLEGIILFPKDKLTFRQQSQITCWGENIRAL
AVNGSFDQCQQLVKLVFAKREHKGILTTANSMNIVRLLPQIIFYAFTSIQLALRHNHSVN
FIVPGGNLGNVTACYWAKMLGFPVEQILIANNTNSALGEFLLTGAYQAKSVTKTLATAMD
VGEPSNLERLFVLFNNYSECKKQMNAESVSDEQIKQAILHCYNKYHYIICPHTATAYHRL
STINQDKPWVIVAPGHPAKFEEVLEPLLKKEIPVPEQLKILLGRKQHYSIIEPNYHSLYH
FLVE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
ctgcagatgaaaattagaataaagagtacgagaggacaatgtatctccacaatagacgaa
gcaatactgtcaggcttggcaggggatggcgggttatttgtaccggacaggttccccgat
ttaacaataaaaaaattttatgaatacggtaatttaatcgacttttctgctcatttactc
tcgccatttttttcagatagtaaaattgatgtaaataatgctttttttcaaaaattcctc
accttctcctttccgctgcattatctttttaagaaaagttatgtactcgagttgtttcat
gggccaaccctgtctttcaaagatttaggaactcaatttttcagtgaatgtttattgcat
ctgatagaaaacaagagcgccaaagtcctggtcgcaacatctggtgatactggcgctgcg
attgctcatgctttgcatgggaaaagagatctggaaggaatcattttatttcccaaagat
aaacttactttcagacaacaatctcaaattacttgttggggggagaatattcgtgcattg
gctgttaatggcagttttgatcaatgtcaacagctggtgaagctggtatttgccaaaaga
gaacataaaggaatattgactacagccaatagcatgaatattgtcagattattaccacag
attattttttatgcttttaccagcattcaactggcattaagacataatcattctgttaat
tttatagttccaggcggaaacctgggtaatgttacggcttgttattgggcaaaaatgctg
ggttttccggttgaacaaattttaatagctaataatactaatagtgcactgggcgaattt
ttattaacgggagcttatcaagccaaatcggttactaaaacattggcaacagcgatggat
gtaggtgagccaagcaatttggagcgcttattcgttttatttaataattattctgaatgt
aaaaaacagatgaatgcagaatctgttagtgatgaacaaattaagcaagctatcctacat
tgttacaataaatatcattatataatttgccctcataccgctacagcttatcatcgtcta
agtacaatcaatcaggataaaccctgggttattgtggcaccagggcacccggcgaaattt
gaagaggtattagaaccactattgaaaaaagaaatccctgtcccggaacagctgaagatc
cttttaggcagaaaacaacattattcaatcatagagccaaactatcattctttgtatcat
ttcttagttgaatga

DBGET integrated database retrieval system