KEGG   Legionella pneumophila Lens: lpl1466Help
Entry
lpl1466           CDS       T00208                                 

Definition
(GenBank) hypothetical protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00010  Glycolysis / Gluconeogenesis
lpf00020  Citrate cycle (TCA cycle)
lpf00620  Pyruvate metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Module
lpf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl1466
   00020 Citrate cycle (TCA cycle)
    lpl1466
   00620 Pyruvate metabolism
    lpl1466
Enzymes [BR:lpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpl1466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 GCV_H Bac_DNA_binding Bclx_interact
Motif
Other DBs
NCBI-ProteinID: CAH15706
Pasteur: lpl1466
UniProt: Q5WWI7
Position
complement(1635274..1636386)
Genome map
AA seq 370 aa AA seqDB search
MNIFNLPDLGEGLPDAEIHEWFVKEGDTVKADQPLVSMETAKAVVDVPCPQSGTIAKLYG
KPGDVIKTGEPLVEFVSTTEKPADKGTVVGNLEESTDVSEDNFIIGSQRSSHRVKTTPAV
RLLAKKLGVDLSSLKGSGDNGVITREDVQNQANINSQPPVGFEPLRGVRRAMLNSMVQSH
AEIVPVSIFDEADIHSWKPNTDITVRLIRAIIHASKKEPALNAWFDTKHAARRCFKEVHL
GIAMDNEEGLFVPVIHDAEKYSDSELRKIIDEFKESVRNRAVSADKLKGATITLSNFGKF
SGRFASPIIVPPMVAILAVGRLYKAAVINDEDKIEAHKMLPLSLSFDHRAITGGEATRFL
GAVIESLQQA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaatatttttaatctacccgatttaggtgaaggtttacctgacgctgaaattcatgaa
tggtttgttaaggaaggcgacacagttaaagcagatcaacccttagtttctatggaaacg
gcaaaagcagttgttgacgtaccctgccctcaatcaggcactatcgcaaaactttatggc
aaaccaggtgacgttatcaaaacaggtgagcctcttgtagagtttgtttcaactaccgaa
aaacctgcagataaaggcacagttgttggtaatctggaggaaagtactgatgtgtcagaa
gataattttattattggaagtcagcgttcttctcaccgcgttaagacaacacctgctgta
agattgttagcaaaaaaattaggagttgatttaagctctttaaaaggtagtggtgacaat
ggtgttattactcgagaagatgttcaaaatcaggccaatatcaattcacaaccacctgtt
gggtttgagcccttgcgaggtgttaggcgagccatgcttaatagcatggtacaatctcat
gcagaaatagttccagtcagtatttttgatgaagcagatatccatagttggaaacccaac
acagacattactgttcgtttaatccgggctattatccatgcgtcaaaaaaggaacctgct
cttaatgcctggtttgataccaaacatgctgcacgcagatgctttaaagaagtgcatctt
ggcattgccatggacaatgaggaaggtttgtttgttcctgttatccatgatgcagaaaaa
tactccgacagtgaattaagaaaaataattgatgaattcaaagagtcagttcgtaatcgg
gcggttagtgcagacaagctaaaaggggcgacaattacgttgtctaattttggaaaattt
tcaggacgttttgccagtccaataattgttcctccaatggtagcgattttagcggttgga
agactttataaagccgcagtaattaatgatgaggataaaattgaagctcacaaaatgctt
cctttatccttgagctttgatcatagagctattaccggaggagaagccactcgattttta
ggtgctgttattgaatccttgcaacaagcatga

DBGET integrated database retrieval system