KEGG   Legionella pneumophila Lens: lpl1487Help
Entry
lpl1487           CDS       T00208                                 

Gene name
folK
Definition
hypothetical protein
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lpf  Legionella pneumophila Lens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lpf00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(1655475..1655900)
Genome map
AA seq 141 aa AA seqDB search
MNVCYLSLGSNQKNPERQIRQAIKEIKQIPSTCLIKVSRLYWNKAWGFENQQEFCNVVIE
IRTTLLPHKLLKWCQKIENRHQRVRRKFWGPRTLDIDIILYGYRLIRTKNLIVPHPCFHL
RDFVLVPLRELNSNLKIPNYT
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtttgctatctgagcttgggatcgaatcaaaaaaatcctgagcgtcaaataaga
caagccattaaagaaatcaaacagattccatcaacatgccttatcaaggtctctcgttta
tattggaataaggcctggggctttgaaaatcaacaggaattttgtaatgttgttatagag
atacgaactactctgttaccccataagctccttaagtggtgccaaaaaatagaaaacagg
caccagcgagtcaggagaaaattttgggggccaagaacattagatattgatatcatttta
tatggttatagattaattcgcacaaaaaacttaatcgttccacatccttgtttccattta
cgagattttgttcttgttcctctaagagaattaaactctaatttaaaaataccaaattac
acatag

DBGET integrated database retrieval system