KEGG   Legionella pneumophila Lens: lpl1523Help
Entry
lpl1523           CDS       T00208                                 

Gene name
aceF
Definition
(GenBank) Pyruvate dehydrogenase (dihydrolipoyltransacetylase component) E2p
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00010  Glycolysis / Gluconeogenesis
lpf00020  Citrate cycle (TCA cycle)
lpf00620  Pyruvate metabolism
lpf01100  Metabolic pathways
lpf01110  Biosynthesis of secondary metabolites
lpf01120  Microbial metabolism in diverse environments
lpf01130  Biosynthesis of antibiotics
lpf01200  Carbon metabolism
Module
lpf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl1523 (aceF)
   00020 Citrate cycle (TCA cycle)
    lpl1523 (aceF)
   00620 Pyruvate metabolism
    lpl1523 (aceF)
Enzymes [BR:lpf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     lpl1523 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 E3_binding GCV_H RnfC_N PYNP_C NQRA HlyD_D23 HlyD_3
Motif
Other DBs
NCBI-ProteinID: CAH15763
Pasteur: lpl1523
UniProt: Q5WWD0
Position
1696494..1698128
Genome map
AA seq 544 aa AA seqDB search
MTKESEIKIPDIGGANQVDVIEILVKEGDQIEVDTPLITLESEKASMDIPSPISGTVTQI
LVKVGDKVSEGDLIVKAKSDTTANISSSQEQKAEPEKQNLQTRAEEQSVDTKATASTPGS
KDIEITIPDIGGANDVDVIDILVKPGMEVEKDQALITLEGDKATMDIPSPYAGKVIEMKI
KLGDKVSQGTPILTLKTPGKSETPDIEKSQIKNISEQSIKEIEKPYEEVKSEPISINSLE
IAESKSILISAGPAVRRLAREFGVDLSLVQGSGRKSRITKEDLQNYIKVRLSEKTTSGGF
SLPSNPAIDFSKFGSIETKPLNKIKKLTGTNVHRSWITIPHVTQFDEADITDLEAFRKSE
SESAKNQDYKLTLLAFVCSVVCKALHAYPQFNASLDASGENLIYKKYYNIGIAVDTPNGL
VVPVIKNVDKLSVIDIAKEMSRLSTKAREKGLTPIDMSGGCFTISSLGGIGGTAFTPIVN
SPEVAILGLSRSIIKPIYDNKEFKPRLMLPISLSYDHRVIDGAEAARFTRFLCDCLGDIR
RVLL
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaagaaagtgaaattaaaattcctgatatcggtggtgctaatcaagttgatgtc
attgagattttagtgaaagagggtgatcagatcgaagtagatacaccattgattacgctt
gagtctgagaaggcaagcatggacatcccttctccaatatctggaacggtaacgcaaatt
ctcgttaaagtcggtgacaaagtatccgaaggcgatctcattgtcaaagccaagtcagat
acaacggcaaatatttccagttctcaagaacaaaaggctgaaccagaaaaacagaatttg
caaaccagagcagaagagcaatctgttgatacaaaggcaactgcatctacacctggttcc
aaagatattgaaataactatcccggatattggtggtgcaaatgacgttgatgtaattgat
attttagtcaaaccagggatggaagtagaaaaggatcaggcattaattacattagagggt
gataaagcaacgatggatattccttcgccctatgcaggtaaagtcatcgaaatgaaaatt
aaattaggagataaagtatctcaaggtactcctattctaactctaaaaaccccaggaaaa
tctgagacacctgatatcgagaaaagccagattaaaaatatctcagaacaatctataaag
gaaatagagaagccatatgaagaagtaaaatccgaaccaatatcaattaatagccttgag
atagctgaatcaaaaagtatcttaatatctgcaggtccagccgtaagaaggttggcaaga
gagtttggagttgatttatctttggttcagggaagtgggagaaaatctcgtattacaaaa
gaagatctgcaaaattatatcaaagtacgtttaagtgaaaaaactacgtctggtggcttc
agcttaccgtcaaatccagccatcgatttcagtaaatttggttcaattgagacaaagcct
ttaaataaaattaaaaaacttactggaacaaacgtacatcgctcctggataaccattcca
catgtcactcaatttgacgaagcagatattacagacctggaagcgtttagaaaatcagaa
tcagagagcgctaaaaatcaagattacaaattaaccctgttagcatttgtttgcagcgta
gtttgtaaggctctccatgcttacccgcaatttaatgcgtcactggatgccagtggtgaa
aatttaatttataaaaaatattataatataggtatagcagtagatacacctaacggtctg
gtggttcctgtaataaagaatgttgataaattgagtgtaattgatattgcaaaggaaatg
tccagactcagtacgaaagctagagaaaagggattaacacctattgatatgtcaggcggt
tgttttacaatttccagccttggaggtataggcggaacggcatttactcctattgtaaat
agcccggaagttgcaattttgggcttatcaagatcaataataaaacccatatacgataat
aaagagtttaagcccagattgatgttacctatttccctttcttacgatcatagagtaatc
gacggcgctgaggcagcccggtttactcgctttctttgtgattgtttaggtgatattaga
agagttttactctga

DBGET integrated database retrieval system