KEGG   Legionella pneumophila Lens: lpl1877Help
Entry
lpl1877           CDS       T00208                                 

Gene name
pfp
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpl1877 (pfp)
   01230 Biosynthesis of amino acids
    lpl1877 (pfp)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl1877 (pfp)
   00030 Pentose phosphate pathway
    lpl1877 (pfp)
   00051 Fructose and mannose metabolism
    lpl1877 (pfp)
   00052 Galactose metabolism
    lpl1877 (pfp)
  Energy metabolism
   00680 Methane metabolism
    lpl1877 (pfp)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    lpl1877 (pfp)
Enzymes [BR:lpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     lpl1877 (pfp)
Protein phosphatases and associated proteins [BR:lpf01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     lpl1877 (pfp)
Messenger RNA biogenesis [BR:lpf03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     lpl1877 (pfp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2102901..2104145
Genome map
AA seq 414 aa AA seqDB search
MSVKNAIYAQSGGVTAVINASACGVIQTAKLFPEQIGKVYAAKNGIIGALNEELIDTSLE
SEEDIAKLMQTPSGAFGSCRYKLKDNGEEYQRLIAVFKAHNIGYFFYNGGGDSQDTAHKV
SQLGKTMGYPITCIGIPKTVDNDLPFTDNCPGFGSVAKYIAISTKEAGFDVASMAASSTK
VFILEVMGRHAGWIAAASGLAEQNPGEPPHIILLPEVPFEPTRFLKKVKDCVNSYGYCVI
VVSEGIRNKEGKFLSEAGLRDAFGHAQLGGVAPVIAQLIKSELGFKYHWAVADYLQRAAR
HIASQVDLDQAYALGKAAVEYAVKGYNAIMPIVIREQDEPYQWSIGQVPLAEVANQEKSM
PPEYIAEDGMGITDACKRYLSPLIQGEAYPNYKNGLPDYVRLKNQLVAKKINQD
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttaaaaatgcaatctacgcccagtcgggtggcgtgaccgctgtaattaatgca
tccgcttgtggtgtcattcaaacagccaaactatttccagagcaaattggtaaagtttat
gctgcaaaaaatggcattatcggtgccttaaacgaggaattaatcgatacttcattggaa
agtgaagaagacattgccaaattaatgcaaactccttccggagcttttggctcctgccgc
tacaaattaaaagacaatggggaagagtatcaacgcttgatcgctgtcttcaaggcgcac
aacataggatatttcttttacaatggcggcggggactcacaagatactgcccataaagta
tcccagctgggtaaaaccatgggctatcctattacctgcataggtatccctaaaacagta
gataacgatctgccttttacagacaattgcccggggtttggatcagtcgcgaaatacatt
gccatttcaacgaaggaagctggttttgatgtcgcgtccatggcagcttcatccacgaaa
gtgtttattcttgaggtgatgggaaggcatgcaggctggatagctgcggctagtgggctg
gccgagcaaaatccaggcgaaccgccacacattatcctattgcctgaagttccttttgag
ccaactcgttttctaaaaaaagtgaaagactgtgtcaattcgtatggttattgtgtgatt
gttgtttcagaaggtatccgcaataaggaaggaaaatttctcagtgaagcaggattacgc
gatgcattcggacatgcccaattaggtggtgttgcaccagtcatcgcccaattgattaaa
tcagaacttggttttaaataccattgggcagttgcagattatcttcaacgggcagccaga
cacatagcctcgcaggttgatttggatcaagcttatgctttaggtaaggctgctgtggaa
tatgccgtaaaaggatataacgcgataatgcctattgttattcgtgaacaagacgagcct
tatcaatggtccataggtcaagtccctctggctgaggtagctaaccaggaaaagtctatg
ccaccagagtatatagctgaagatggcatgggaattacggacgcatgcaaacgttacttg
tcccctttgattcaaggtgaagcttatcccaattacaaaaatggattaccggattatgtc
cgactaaaaaaccagttagtggctaaaaaaatcaatcaagattaa

DBGET integrated database retrieval system