KEGG   Legionella pneumophila Lens: lpl2517Help
Entry
lpl2517           CDS       T00208                                 

Gene name
fmt
Definition
hypothetical protein
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
lpf  Legionella pneumophila Lens
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:lpf00670]
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lpf00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2871705..2872649)
Genome map
AA seq 314 aa AA seqDB search
MNGLTVVFAGTPEFGLPCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINHQI
SVYQPLNFKNQEAVDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGA
SPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKAACPVTSSDTAGSLHDKLAKMSVKPLL
DVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLA
GELMLRIHQAKATDIMSTEMPGMVLNIDKTGMLVATSDNALLVEKIQFPGAKVISVRDWL
NSGKTQLHTGLMLQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtttaactgtcgtttttgctggaactccagaatttggcttaccctgtctggat
gctttaattcaatcaaggcatcatctcaaggctgtttatactcagcccgacaggccggct
ggccgaggccgtaaattacaggagtctcctgtaaaagaatgggcaataaatcaccagata
tcagtttatcaaccgcttaattttaaaaatcaagaagctgtcgatgaactttctgcctta
aagcccgatgtaatggtcgtgatagcgtatggattaatattaccaaaagcagtgttggaa
attcctcgtctgggttgtattaatgtgcatgcttctctgttaccgcgctggcgtggcgca
tctccaatacaacatgccattttacatggtgatgctgaatccggagtgaccattatgcaa
atggatgttggattggatacaggtcctatgttatgcaaggccgcctgtcctgtgacttcc
tcggataccgctggtagtttgcatgataaattagcaaaaatgtcagtaaaaccattattg
gatgttttggaggctttagcatccaattcagcacaatttgaattacaaaacaatgagtta
gcgacttatgctggtaaaattaataaagaagaggcacgaattaactggcatcagtctgca
gtggaaatagatagaaaaattcgcgcatttaatccatggcctgttgcctatacgctggct
ggggaattaatgctcagaattcaccaggcaaaagcaactgatatcatgagtaccgagatg
ccgggcatggtattaaatatcgataaaactggaatgttggtcgctaccagtgataatgca
ttgttagtggaaaagattcaatttcccggagcaaaggtcatttcagtcagggattggtta
aattcgggtaaaacacaattgcatactggtttaatgttgcaatga

DBGET integrated database retrieval system