KEGG   Legionella pneumophila Lens: lpl2517Help
Entry
lpl2517           CDS       T00208                                 

Gene name
fmt
Definition
hypothetical protein
Orthology
K00604  
methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
lpf  Legionella pneumophila Lens
Pathway
One carbon pool by folate
Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    lpl2517 (fmt)
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    lpl2517 (fmt)
Enzymes [BR:lpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     lpl2517 (fmt)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(2871705..2872649)
Genome map
AA seq 314 aa AA seqDB search
MNGLTVVFAGTPEFGLPCLDALIQSRHHLKAVYTQPDRPAGRGRKLQESPVKEWAINHQI
SVYQPLNFKNQEAVDELSALKPDVMVVIAYGLILPKAVLEIPRLGCINVHASLLPRWRGA
SPIQHAILHGDAESGVTIMQMDVGLDTGPMLCKAACPVTSSDTAGSLHDKLAKMSVKPLL
DVLEALASNSAQFELQNNELATYAGKINKEEARINWHQSAVEIDRKIRAFNPWPVAYTLA
GELMLRIHQAKATDIMSTEMPGMVLNIDKTGMLVATSDNALLVEKIQFPGAKVISVRDWL
NSGKTQLHTGLMLQ
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtttaactgtcgtttttgctggaactccagaatttggcttaccctgtctggat
gctttaattcaatcaaggcatcatctcaaggctgtttatactcagcccgacaggccggct
ggccgaggccgtaaattacaggagtctcctgtaaaagaatgggcaataaatcaccagata
tcagtttatcaaccgcttaattttaaaaatcaagaagctgtcgatgaactttctgcctta
aagcccgatgtaatggtcgtgatagcgtatggattaatattaccaaaagcagtgttggaa
attcctcgtctgggttgtattaatgtgcatgcttctctgttaccgcgctggcgtggcgca
tctccaatacaacatgccattttacatggtgatgctgaatccggagtgaccattatgcaa
atggatgttggattggatacaggtcctatgttatgcaaggccgcctgtcctgtgacttcc
tcggataccgctggtagtttgcatgataaattagcaaaaatgtcagtaaaaccattattg
gatgttttggaggctttagcatccaattcagcacaatttgaattacaaaacaatgagtta
gcgacttatgctggtaaaattaataaagaagaggcacgaattaactggcatcagtctgca
gtggaaatagatagaaaaattcgcgcatttaatccatggcctgttgcctatacgctggct
ggggaattaatgctcagaattcaccaggcaaaagcaactgatatcatgagtaccgagatg
ccgggcatggtattaaatatcgataaaactggaatgttggtcgctaccagtgataatgca
ttgttagtggaaaagattcaatttcccggagcaaaggtcatttcagtcagggattggtta
aattcgggtaaaacacaattgcatactggtttaatgttgcaatga

DBGET integrated database retrieval system