KEGG   Legionella pneumophila Lens: lpl2557Help
Entry
lpl2557           CDS       T00208                                 

Gene name
holC
Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpf  Legionella pneumophila Lens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    lpl2557 (holC)
   00240 Pyrimidine metabolism
    lpl2557 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    lpl2557 (holC)
   03430 Mismatch repair
    lpl2557 (holC)
   03440 Homologous recombination
    lpl2557 (holC)
Enzymes [BR:lpf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     lpl2557 (holC)
DNA replication proteins [BR:lpf03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     lpl2557 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2920881..2921315
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYTKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKKYRNKGCALHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctataccaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattgtggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccggagcctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaaaaatatagaaacaaaggctgtgcattgcacaca
cactcgattgaataa

DBGET integrated database retrieval system