KEGG   Legionella pneumophila Lens: lpl2557Help
Entry
lpl2557           CDS       T00208                                 

Gene name
holC
Definition
hypothetical protein
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
lpf  Legionella pneumophila Lens
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lpf00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lpf00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:lpf03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:lpf03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lpf03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2920881..2921315
Genome map
AA seq 144 aa AA seqDB search
MSPIRVDFYLLASSLPESRWLVACRLIEKAYTKGHTIFVFCDNQQQAEYLDELLWTFKDD
SFIPHNLQGEGPEPPPPVQIGYQKEPRGFTDILLNLSTNIPIFYTRFKRVIELVSNVEHE
KEVSRLHYKKYRNKGCALHTHSIE
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaattcgcgttgatttttacttattagccagcagccttccagaatctcgctgg
ttggttgcttgtcgtttaatagaaaaagcctataccaaaggacatactatttttgttttt
tgcgacaatcagcaacaagcagaataccttgatgaattattgtggactttcaaagacgac
agttttattcctcataatttgcaaggtgaaggaccggagcctcctcctcccgtacaaatt
ggctatcaaaaagaacccagaggctttacagatatcctgttgaatttatccaccaatatt
ccaattttttatacccgatttaaaagagtcattgaattggtgagtaatgtagaacatgag
aaagaagtgagtcgattgcactataaaaaatatagaaacaaaggctgtgcattgcacaca
cactcgattgaataa

DBGET integrated database retrieval system