KEGG   Legionella pneumophila Lens: lpl2588Help
Entry
lpl2588           CDS       T00208                                 

Gene name
panB
Definition
3-methyl-2-oxobutanoate hydroxymethyltransferase
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
lpf  Legionella pneumophila Lens
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    lpl2588 (panB)
Enzymes [BR:lpf01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.11  3-methyl-2-oxobutanoate hydroxymethyltransferase
     lpl2588 (panB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2955546..2956334
Genome map
AA seq 262 aa AA seqDB search
MKIHDFKIKKQEQKKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGYPTTIMATIE
MMELHTQAVARGLGKQFLITDLPFLGHKSSQGHTVENVKRLLQAGAQAVKIEGADKDTCQ
TISHLVNAGIPVMGHIGLTPQSIHQLGGYKIQGKNSEQAETLLQQATTLEQAGCFAVVIE
CVPQDLAKTITDSLVIPTIGIGAGPGTDGQVLVWHDMLGLQTSFNPKFVKKYFRAKDHFI
EALNSYVQQVQQMHFPANEHSF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgattttaaaataaaaaagcaggaacaaaagaaaatttccatgttgacc
tgttacgattacccttcagcatgcatagtagcagaatcaaatatcgattgtgttctcgtg
ggtgattctgtagccatggcagtacacggctaccctacaaccattatggccactatcgaa
atgatggaattacatacccaggcagtagctcgtggtttaggcaagcagtttttgattact
gacttaccttttctcggacataaatcatctcaaggtcatacagtagaaaacgtaaaaagg
ctgttacaggctggagcccaagcagttaaaatcgagggcgctgataaagacacctgccaa
acgatttcccatttagttaatgccggcatccctgttatgggtcatatcggcttaactccc
caatccattcatcaattaggcggttataaaatccagggaaaaaacagcgaacaggcagaa
actctattacaacaggcaaccaccctggaacaagccggctgctttgcggtagtcattgaa
tgtgttccgcaggacctggcaaaaacgattaccgattcgttggttattcctactatagga
attggcgctggcccaggaactgatgggcaagtccttgtctggcacgatatgctaggttta
cagacttcatttaatcctaaatttgtaaaaaaatattttagagccaaagaccattttatt
gaagccttaaacagctatgtccagcaagtacaacaaatgcatttcccagctaatgaacat
tctttctag

DBGET integrated database retrieval system