KEGG   Legionella pneumophila Lens: lpl2588Help
Entry
lpl2588           CDS       T00208                                 

Gene name
panB
Definition
3-methyl-2-oxobutanoate hydroxymethyltransferase
Orthology
K00606  
3-methyl-2-oxobutanoate hydroxymethyltransferase [EC:2.1.2.11]
Organism
lpf  Legionella pneumophila Lens
Pathway
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:lpf00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
2955546..2956334
Genome map
AA seq 262 aa AA seqDB search
MKIHDFKIKKQEQKKISMLTCYDYPSACIVAESNIDCVLVGDSVAMAVHGYPTTIMATIE
MMELHTQAVARGLGKQFLITDLPFLGHKSSQGHTVENVKRLLQAGAQAVKIEGADKDTCQ
TISHLVNAGIPVMGHIGLTPQSIHQLGGYKIQGKNSEQAETLLQQATTLEQAGCFAVVIE
CVPQDLAKTITDSLVIPTIGIGAGPGTDGQVLVWHDMLGLQTSFNPKFVKKYFRAKDHFI
EALNSYVQQVQQMHFPANEHSF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatccatgattttaaaataaaaaagcaggaacaaaagaaaatttccatgttgacc
tgttacgattacccttcagcatgcatagtagcagaatcaaatatcgattgtgttctcgtg
ggtgattctgtagccatggcagtacacggctaccctacaaccattatggccactatcgaa
atgatggaattacatacccaggcagtagctcgtggtttaggcaagcagtttttgattact
gacttaccttttctcggacataaatcatctcaaggtcatacagtagaaaacgtaaaaagg
ctgttacaggctggagcccaagcagttaaaatcgagggcgctgataaagacacctgccaa
acgatttcccatttagttaatgccggcatccctgttatgggtcatatcggcttaactccc
caatccattcatcaattaggcggttataaaatccagggaaaaaacagcgaacaggcagaa
actctattacaacaggcaaccaccctggaacaagccggctgctttgcggtagtcattgaa
tgtgttccgcaggacctggcaaaaacgattaccgattcgttggttattcctactatagga
attggcgctggcccaggaactgatgggcaagtccttgtctggcacgatatgctaggttta
cagacttcatttaatcctaaatttgtaaaaaaatattttagagccaaagaccattttatt
gaagccttaaacagctatgtccagcaagtacaacaaatgcatttcccagctaatgaacat
tctttctag

DBGET integrated database retrieval system