KEGG   Legionella pneumophila Lens: lpl2673Help
Entry
lpl2673           CDS       T00208                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lpf  Legionella pneumophila Lens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpl2673 (recR)
DNA repair and recombination proteins [BR:lpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpl2673 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3050907..3051500
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcctggtgtgggaccaaaa
tcagcacaaagaatggtgttccatttattgcagcaccaaagacagcgagggttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgccagcagtgtaataattac
accgaacaaactctgtgtactctttgccaaaaccccaatcgagattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgacataggt
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
accgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtctaa

DBGET integrated database retrieval system