KEGG   Legionella pneumophila Lens: lpl2673Help
Entry
lpl2673           CDS       T00208                                 

Gene name
recR
Definition
(GenBank) Recombination and repair protein recR
  KO
K06187  
recombination protein RecR
Organism
lpf  Legionella pneumophila Lens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    lpl2673 (recR)
DNA repair and recombination proteins [BR:lpf03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     lpl2673 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      lpl2673 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Pasteur: 
UniProt: 
Position
3050907..3051500
Genome map
AA seq 197 aa AA seqDB search
MDALSRLVEALRCLPGVGPKSAQRMVFHLLQHQRQRGLHLASCLEQAMKHISHCQQCNNY
TEQTLCTLCQNPNRDSTLLCVVESPADVSAIEQSNSFQGKYFVLMGKISPLDGLGPDDIG
LPKLKELIIREKIQEVILALSPSVESQTTIHFIHQLLKDETVNISQLAHGIPSGGELEFL
DGNTISSALKNRAVINV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atggatgctctaagccgcttggtagaggcgcttcgctgtcttcctggtgtgggaccaaaa
tcagcacaaagaatggtgttccatttattgcagcaccaaagacagcgagggttacacctt
gcctcctgtttggaacaggcaatgaagcacattagtcattgccagcagtgtaataattac
accgaacaaactctgtgtactctttgccaaaaccccaatcgagattcaacattactttgc
gtggtagagagtccagcggatgtttctgccatagaacaaagcaattcctttcaaggtaaa
tattttgtccttatgggaaaaatttctcctcttgatggcttgggacctgatgacataggt
ctaccgaaacttaaggagttaattattagggaaaaaattcaggaagttattcttgcatta
agccccagtgttgaaagccagaccacaattcattttattcatcagttgctaaaggatgaa
accgtcaatatcagtcagttagcacatggaataccatcaggtggtgaattagaattttta
gatgggaatactataagcagtgcccttaagaacagagctgtgattaatgtctaa

DBGET integrated database retrieval system