KEGG   Legionella pneumophila Lens: lpl2683Help
Entry
lpl2683           CDS       T00208                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
lpf  Legionella pneumophila Lens
Pathway
lpf00790  Folate biosynthesis
lpf01100  Metabolic pathways
Module
lpf_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpl2683 (folE)
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     lpl2683 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI
Motif
Other DBs
NCBI-ProteinID: CAH16924
Pasteur: lpl2683
UniProt: Q5WT42
Position
3061534..3062073
Genome map
AA seq 179 aa AA seqDB search
MEKLYSNLLKELGEDINREGLKDTPGRAANALRYLTKGYNENLDEIINGALFDSDMSEMV
IVKDIELYSLCEHHLLPFLGKCHVGYLPDGKVIGLSKIARIVDFYARRLQIQERLTGEIA
HCIESTTGARGVAVVIEAKHLCMMMRGVEKQNSVMTTSVMLGEMRNNSSCRLEFLNLIR
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattatactcaaatttgcttaaagaattaggcgaagatataaatcgggaagga
ttaaaggatactcctggacgagcagccaatgccttacgttatttaactaaaggttacaat
gagaacctagatgaaatcattaacggtgctctgtttgattcagacatgagtgaaatggtt
atcgtcaaggacatagaactgtactcattatgcgaacatcacttattgccttttttgggt
aaatgccatgttggatatctacctgatggtaaagtaataggcttatctaaaattgctcgt
attgttgatttttatgcgaggagactacaaattcaagaacggctgacgggcgaaattgct
cactgtattgaatccactaccggagctcgcggtgtcgccgtagtgattgaagcaaaacat
ctttgcatgatgatgcgtggagttgaaaaacaaaattctgtcatgacaacttcagttatg
ctcggtgaaatgcgtaacaattcgagttgccgtttggaattcttaaatttaattcgttaa

DBGET integrated database retrieval system