KEGG   Legionella pneumophila Lens: lpl2707Help
Entry
lpl2707           CDS       T00208                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lpf  Legionella pneumophila Lens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    lpl2707 (tpiA)
   01230 Biosynthesis of amino acids
    lpl2707 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    lpl2707 (tpiA)
   00051 Fructose and mannose metabolism
    lpl2707 (tpiA)
   00562 Inositol phosphate metabolism
    lpl2707 (tpiA)
Enzymes [BR:lpf01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     lpl2707 (tpiA)
Exosome [BR:lpf04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   lpl2707 (tpiA)
  Exosomal proteins of bladder cancer cells
   lpl2707 (tpiA)
  Exosomal proteins of melanoma cells
   lpl2707 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3087535..3088284)
Genome map
AA seq 249 aa AA seqDB search
MRQKIVAGNWKMNGQIQQVTELVSQIEKLIGFDCAAQVAVMPPSIYIPKVRDCLRTGKIV
VGAQNVYPKDYGAYTGELSAPMLKDFDCRYVLVGHSERRQFFHEDENFVAQKFHHVKDHG
MIPVLCVGETLSERENGKTEQVIAQQVLAVSAKGKDCFRDCVVAYEPVWAIGTGKTATPE
QAQKIHQFIRDLVGEINDSDAKHLTLIYGGSVNENNAKALFSMPDIDGGLVGGASLNAKQ
FVEIVKCIN
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
gtgaggcaaaagatagttgctggtaactggaaaatgaatggccagattcaacaggtgact
gaattggtttcgcaaattgagaaattaattggctttgattgcgcagcacaggttgctgta
atgcctcccagcatttatatacccaaggtaagagactgcttaaggacggggaagattgta
gtaggtgcgcaaaatgtttatccgaaagattatggtgcctacacaggtgaactgtcagct
cccatgcttaaagattttgattgccgatatgttctggtggggcactcggagcgcaggcaa
ttttttcatgaagatgaaaattttgtggcgcaaaaattccaccatgtcaaagatcatggt
atgatacctgttctttgtgttggtgaaactctttctgaaagagagaatggaaaaacagag
caggttattgctcaacaggtgctcgcagtgagtgcaaaagggaaagattgttttcgtgat
tgcgtagtggcttatgagcctgtatgggcaattgggacaggaaaaactgctacacctgaa
caggcacaaaaaatacaccagtttattagagatctggttggagaaataaatgatagcgat
gcgaaacatttgacgctcatatatggtggcagtgttaatgaaaataatgcaaaagcctta
ttttccatgccagatattgatggagggttagtgggtggagcatcgttgaatgcaaaacaa
tttgtggaaattgtgaaatgtatcaattga

DBGET integrated database retrieval system