KEGG   Legionella pneumophila Lens: lpl2710Help
Entry
lpl2710           CDS       T00208                                 

Gene name
folP
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
lpf  Legionella pneumophila Lens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lpf00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    lpl2710 (folP)
Enzymes [BR:lpf01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     lpl2710 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
complement(3093387..3094181)
Genome map
AA seq 264 aa AA seqDB search
MGVLNVTSDSFYDGGKYLSVDRACDQALKLIACGADLIDIGGESTKPGAPPVPLDVELSR
VLPVIKQLRALADVCISIDTNKPEVMEAAIDAGANVINDVYALRRDGALNVAAQLDVPVC
LMHMKGEPRTMQENPSYPEGIMKELQHFFEERIDKCQKAGLNKNKLILDPGFGFGKRIKD
NLKLIYHLNELRSFGLPILLGVSRKSTIGAVLNNEVEQRLIGSITLGIYAALKGTAIIRT
HDVDETNQALTMINAIYQAAKEIS
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcttaaatgttacctcggactcattttatgatggtggcaagtatctgtctgtt
gatagagcctgtgatcaggctttaaaattaattgcatgtggagctgatctcattgatata
ggtggggaatcaaccaaacctggtgcgccgccagtccctttagatgttgaactatcaaga
gttcttcccgtaatcaaacaacttcgtgccctcgcagatgtgtgtatttctattgatact
aataagcctgaagtgatggaagcggcaatcgatgctggtgcgaatgttataaatgatgtt
tatgctttaagaagggatggtgctttgaatgttgctgcgcagttagatgttcctgtttgt
ttaatgcacatgaaaggagagcctcgaactatgcaagaaaatccttcttacccagaagga
ataatgaaggaattacagcatttttttgaagagcgcatcgataaatgccagaaagccggg
ctgaataagaataaattaattcttgaccctggctttggttttggaaagcgcattaaagat
aacctaaaattaatttatcatctgaacgaattgcgttcttttggattgccaattcttttg
ggcgtttcacgcaaaagcacaattggtgctgtattgaataatgaagttgagcaacgtttg
attggaagtattacgctaggaatatatgctgctcttaaaggcactgcaattatcaggaca
catgatgtggatgaaacgaatcaagcattaactatgattaatgcaatttatcaagctgct
aaagaaatcagttaa

DBGET integrated database retrieval system