KEGG   Legionella pneumophila Lens: lpl2757Help
Entry
lpl2757           CDS       T00208                                 

Definition
hypothetical protein
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lpf  Legionella pneumophila Lens
Brite
Enzymes [BR:lpf01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     lpl2757
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Pasteur: 
UniProt: 
Position
3155534..3156295
Genome map
AA seq 253 aa AA seqDB search
MRRGKHLSELQSEEANLLAPVNQRGKGTERALLVLHGFSSSPAVYRYLIPNLKNYDAILC
PVLAGHAESIEAFSKSKAADWLQSAKNACELLINQYQKVDVLGLSLGGLLACQLSQSYAI
NHLFLLAPALKLHMRINAMLKLAQILKCLGFRQLRNAAGNIITDEHAEIAYRKLPISTII
EMLTLARGYEWLPPTCPADLFLGIHDQVVASQQVEQLFCNLPNVKIHWLKNSAHVLPLDN
DLNEIIDCINRNK
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcggcaaacatctcagcgaactgcagtcggaggaagcaaatctccttgctcca
gtcaatcagcgtggtaaaggcacagaacgagctttactggtattgcatggtttctcttct
tcaccggcagtttaccgatatctgatacctaatttaaaaaattatgatgccatcctttgt
cctgtattggctggtcacgccgaaagtatagaagccttttcaaaatccaaagctgctgat
tggcttcaatcagcaaaaaacgcctgtgaactcttaataaatcagtatcaaaaagttgat
gttttaggattatccctgggaggattattagcctgtcaattaagtcaatcctatgctatc
aatcacctgtttctattagcccccgcattaaaattacacatgcgcatcaacgccatgctg
aaattagcccaaattcttaagtgcctcggatttcgacaacttcgcaacgctgcagggaat
attatcactgatgagcatgccgaaatcgcttatagaaagcttcccatttccacaatcatt
gaaatgctaaccttggctcggggatatgaatggctgccaccaacttgcccggccgatctt
tttcttggaattcatgatcaagtggttgcttctcaacaagtagaacaattattttgtaat
ttacctaatgtaaaaatacattggttaaaaaattccgcgcatgtattgccactagacaat
gatctgaatgaaattattgattgtattaatagaaacaaatga

DBGET integrated database retrieval system