KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_0665Help
Entry
LPV_0665          CDS       T02174                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    LPV_0665
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    LPV_0665
Enzymes [BR:lph01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     LPV_0665
Lipid biosynthesis proteins [BR:lph01004]
 Desaturase
  First
   LPV_0665
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648004..649191
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVVSHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKHEKNTGIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacctgtctttctggggatatgttctcgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatcttcatcggaatcagactcatagagcg
ctaacattgcaccctgtggtcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagatcctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgag
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacacca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggtatcggccattattggggatac
aggaattttgaatgtcccgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcttcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttcccttttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaagttccatgttgatctg
gatactgtgagagcagttatttcaaatcgctttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagcatgaaaaaaacaccggcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgcccaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system