KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_0665Help
Entry
LPV_0665          CDS       T02174                                 

Definition
putative Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:lph01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:lph01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
648004..649191
Genome map
AA seq 395 aa AA seqDB search
MVFGFLNLSFWGYVLATFILTQITIASVTIYLHRNQTHRALTLHPVVSHFFRFWLWLTTG
MVTADWVAIHRKHHATTDVEGDPHSPVVEGIRKVFWQGAELYREARKDRDMVAKYSHGTP
TDWIERNVYSRHSSKGILLMLLLDLFFFGIPGMTVWAIQMMWIPLFAAGVINGIGHYWGY
RNFECPDAATNIIPWGFWIGGEELHNNHHTFASSAKFSVKWWEFDIGWMYIRILSLFGLA
KVKKLPPKLAMDEGKFHVDLDTVRAVISNRFQVMSNYYKNVIRPILKHEKNTGIETKEDK
KLFQRAGRLLRREDKLLSTKAKTRLQKLLDAREQLRVVYSYKQSLQNVWLKTATTQKELV
EALQQWCRQAEESGLDVLKQFAQQLKGYVPVYTRE
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggtattcggctttttaaacctgtctttctggggatatgttctcgcaacttttatcctg
actcaaatcacaattgcatctgttactatctatcttcatcggaatcagactcatagagcg
ctaacattgcaccctgtggtcagtcattttttccgtttttggttatggttaactacgggt
atggttactgcggattgggttgctatccatcgcaagcaccatgcaacaactgatgttgag
ggagatcctcatagcccagtggttgagggaatcaggaaggtattttggcaaggcgctgag
ctttacagagaggcacgcaaggacagggatatggttgccaaatattctcatggcacacca
accgattggatagagcgtaatgtctactcgcgccattcaagtaaaggtattttgctgatg
ttattactggatttatttttcttcgggattcctggaatgactgtatgggcaatccaaatg
atgtggattccgctgtttgctgcgggagtcatcaatggtatcggccattattggggatac
aggaattttgaatgtcccgatgctgctactaatatcattccctggggattttggattggt
ggagaagagttacataataatcatcacacttttgcttcctcagccaaattttcagtgaaa
tggtgggagtttgatattggttggatgtatattcgcattctttcccttttcggtttggcc
aaggtaaaaaaattacctcccaaattggctatggatgaaggaaagttccatgttgatctg
gatactgtgagagcagttatttcaaatcgctttcaagtgatgtctaattactataagaat
gtcatcagacctattttgaagcatgaaaaaaacaccggcattgagacaaaagaagacaag
aaattgtttcaacgggcaggtagattactgcgtcgagaggataagctattatcgacaaaa
gctaaaactcgtttgcaaaaactgctcgatgcccgcgaacagttgagagtggtttactct
tacaagcaatcattacaaaatgtttggctgaaaacagcaacgactcaaaaagaattagta
gaagctctgcagcaatggtgccgccaggcagaggaatcgggtcttgatgtgctgaaacag
tttgcccaacaattgaaaggctacgtaccggtatataccagggagtga

DBGET integrated database retrieval system