KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_1163Help
Entry
LPV_1163          CDS       T02174                                 

Definition
putative thymidine phosphorylase (TdRPase) (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:lph00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1170193..1171707
Genome map
AA seq 504 aa AA seqDB search
MSKQTSHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVTLGQRSIIATLNVV
TSELLQPGEAGLSDYAWESLHAKEGDEIQVSHPKPLESLSYVHTKIYGKELSYEQMKVII
DDVLSGRLSDVQISAFLAASASGRLTSTEVMKLTKAMIDSGDRLSWPSPLVVDKHCVGGL
PGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLAPVHLSPQKMRQVVEQENG
CIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATHAVIDIPVGPTAKV
RNQSMALLLKQLLEEVGNELGLVVHTLLTDGSQPVGYGIGPSLEARDVLAVLQGLPDAPN
DLRERALTLAGAALECSSKVQPGLGKSIAKQLLESGQAFKKFQAICEAQGGMRELTKARF
THPVVAAKAGKVSLIDNRKLAKIAKLAGAPKSKSAGIDLHVHVGESVEQGEPLFTIHSES
SGELHYACDVLRDKQDVILLGESP
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagcaaacctctcatgggcttcggttaaaacatttagggattaaaacctatcac
gaagctattatttacatgcgcgaggattgtcatgtttgtcattcggaaggattcgaagta
cagacccgtatccaagtgactttaggtcagcgctctattatagccactcttaatgtggtg
acctcagagctacttcagcctggtgaggctggtttgtcggattacgcctgggagtcttta
catgccaaagaaggcgatgaaattcaggtctcccatccaaaacccttggaatccttaagc
tatgtgcataccaagatttatggcaaagaactgtcttatgaacaaatgaaggtcatcatt
gatgatgtgttaagcggtcgtctttctgatgtacaaatctccgcttttctagcggcaagt
gcctcaggacgtctaaccagtacggaagtgatgaagctcaccaaagccatgattgatagt
ggtgatcgcttatcttggccttcacctctggtcgttgataaacattgtgtgggaggattg
cctggaaatcgcaccactctgattgtggttcccatcgtggctgcctttgggttgatgata
cctaaaacgtcgtcgcgtgccattacatcacctgcggggactgcggataccatggagact
ttagctccagtccacttaagtccccaaaagatgcgccaagtggttgaacaagaaaacggc
tgtatcgtatggggtggggctgtgagtttaagtcctgctgatgacgtgctcatccgtgtg
gaacgagctattgatttagatagtgaagggcaattagtagcttccattctttctaaaaaa
attgcaacaggtgctacacatgcggtcattgatattcccgtaggacctactgccaaagtc
aggaatcagtctatggcgctccttctgaaacaattgcttgaggaggtaggtaacgagtta
gggcttgttgtccatactttattgaccgatggttcacaaccggtaggatatggcattggc
ccatcattagaagctcgcgatgtattggcggtgttgcaaggattgcctgatgcacccaat
gatttgcgtgaacgagcgttgacgcttgcgggtgctgcgttagagtgttcttcgaaagta
caaccgggtttagggaaatccattgcgaagcaattattggaaagtggacaagcctttaag
aaatttcaggccatttgtgaggctcagggtgggatgagggaattgacaaaggcacgtttt
actcatcctgttgtggctgcaaaggcaggaaaagtctccctcattgataatcgaaagctt
gcaaaaattgccaagcttgctggtgcgccaaaatcgaaatcggcgggtattgacctccat
gtccatgtcggcgaatccgttgaacaaggtgagcctttgtttacaattcattcggagtct
tcaggggagctccattacgcctgtgatgttttacgtgacaaacaagacgtaattctttta
ggagaaagcccttga

DBGET integrated database retrieval system