KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_1718Help
Entry
LPV_1718          CDS       T02174                                 

Definition
NAD-glutamate dehydrogenase
Orthology
K15371  
glutamate dehydrogenase [EC:1.4.1.2]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
Taurine and hypotaurine metabolism
Nitrogen metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LPV_1718
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPV_1718
   00330 Arginine and proline metabolism
    LPV_1718
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LPV_1718
Enzymes [BR:lph01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     LPV_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1741537..1746414)
Genome map
AA seq 1625 aa AA seqDB search
MSYKFEEGKDAIVKSVVEKIKQAMTGEQTEFCAEFAKQFYGTVALEDLLEWEVDDLYGAA
VNFWSLICERAPHETKIRIYNPDYERHGWQTTHTVVEVICEDMPFIVDSLRIVINRMGLT
SHLTIHMGGIRVKRDSHNRVTEILPRNGGAAKDDVLHEAPIFIEIDRQTDPATLSELHKN
FERALEDNRAVFEDWDKMRTKVREIIKELDTVPKTIDISEIEETKAFLNWMEDHHFTFLG
LRDYDLIKKGKETILQPIPETGLGVLRQSLSKSNARSITAMGPEAQGLISSPRILVMSKT
NTLASVHRDAYTDYIGVKRFNKKGEVIGERRIIGLYTSAAYHTNPKHIPFLRHKVALIMK
NSNLNPYSHAGKVLLNILETLPRDDLIQGTEDELLEIAMGIFYMQDRKRIRLFARADVYK
RFISCLVYVPKDRFNTELRYAMQKILADSFNAEEITFSTQFSESVLARIHFIVRVNPKNL
PDFDLKEIEQKLIEVGRSWIDDLQHHLHEVYGEEQANALYSRYKNAFPISYSDTFSPRTA
VYDIKHIEMLSPENPLGINFYKPLDESEKSFRLKVYQHDTTIPLSDVLPILEKLGLRAIS
ERPYVLKFEDGKVAWINDFAMQYNKESEFNIDEIKELFQNAFARVWFGDAENDGFNLLVL
AAGLNWREVAVLRTYAKYFRQIGFTFSQDYMETALNNNVGIAKKLVRLFEIRCNPHDSKR
REDRYVALVAEILSDLDNVANLDEDRIIRQYVHAIGATLRTNFYQVDAQGNPKNYISIKL
SSKLIPGVPKPYPMFEIFVYSPRFEGVHLRCGKVARGGLRWSDRREDFRTEILGLMKAQQ
VKNSVIVPSGAKGGFVPKQIPANATREEIMEEGISCYKLFIRGLLDITDNYKEGLIVKPQ
NVVFYDEDDPYLVVAADKGTATFSDIANSISQEYDFWLGDAFASGGSVGYDHKKMGITAK
GAWESVKRHFYELNRDIQNNDFTVVGIGDMAGDVFGNGMLLSRHIKLVGAFNHIHIFVDP
NPEAEASFKERERLFNLPRSNWTDYDKKLISKGGGVFSRSAKSIPVSPEMQKVFGIKQTS
IEPNDLIKAILKADVDLLWSAGIGTYVKSSTESNTSVGDRTNDATRVNANQLRCKVIGEG
GNLGLTQLARVEYSLHGGKVYTDFIDNSGGVNCSDKEVNIKILLNNVVSAGDLTPKQRNE
LLSNMTDEVAKLVLRDNFLQTRAISLTASQALRAIELHARYINELEKTGKIDRTLEFLPD
EKVLMEHKLMGKGLTQPGIAVLMCYSKTILKEQVLASEVPEEDYMNQILIGSFPKPLQER
FSKQMQDHPLRREIIATRLSNIIVNEMGFTYVYRLQDETGASVAAIVRAYMIARSVLNLE
AIWKQIEELGTKISAQAQVDMMMLYVRLSRRVTRWFLRTHRRSMSITQAIELYAKGVDEL
KKSMPAVFGETGRIQYEEHYQERIKEGIPPQLAHELTVTRGLFAATDIIEIAYEENIKIS
KVAEIYFGIGEFLDIAWLRTQIIVHTTENHWESLSREALRDDLDWQQRQLTAAIMGFEPN
NKDLQERLTRWGETHVSLIDRWNYILTALKSSTALNYTMFLVATRELLDLTQTTLQSNLK
MEESF
NT seq 4878 nt NT seq  +upstreamnt  +downstreamnt
atgtcctataaatttgaagaaggtaaagacgcaatagtaaaaagcgttgttgaaaaaatt
aagcaagcaatgactggcgaacaaacagagttttgcgctgaattcgcgaagcaattttat
gggactgtcgcccttgaagatcttctagagtgggaggttgatgatctttatggagcagca
gtcaatttctggtctttgatttgtgaacgtgctccacacgaaacaaaaatcaggatttat
aatcctgattatgaacgtcatggatggcaaaccacacatactgttgtggaagttatctgt
gaagatatgccttttattgtagattctctgaggatagtaattaatcgaatgggattaaca
tctcatcttactattcatatgggaggaattagggttaaaagagacagccataacagggtt
accgaaattcttccaagaaatggtggagctgctaaagatgatgttttacatgaggctccc
atttttatagaaattgatcgacaaacagacccggctaccttatcggagctgcacaaaaat
tttgaacgcgctcttgaggacaatcgagcggtatttgaagattgggataaaatgcgtact
aaagtacgagaaattattaaggagcttgatactgtaccaaagacaattgatatcagtgaa
attgaagagacgaaagcctttttaaattggatggaagatcaccattttacttttttagga
ttgcgagattatgatttgattaaaaaaggaaaagaaaccattttacaacctattcctgaa
acaggattgggagttttacgccaaagtctgagcaaatcaaatgcaagaagtattacggca
atgggaccagaggcacaaggattaatttcatcaccccgcattcttgtcatgtccaaaaca
aatactttagcctctgttcatagagatgcttataccgactatattggtgttaagcgcttc
aataaaaaaggagaggtgattggcgaaaggcgtattataggactgtatacttctgcagct
tatcatacaaatcccaagcatattccgtttttgcgacataaagtcgcattaattatgaaa
aattctaatttaaatccctatagccatgcaggtaaagtattattgaatatacttgaaact
cttccaagagatgatttaattcaaggcactgaggatgagttactggaaatagctatgggt
attttctatatgcaagatagaaaacgtatccgcctgtttgccagagccgatgtttacaag
cgatttatttcatgcttggtatatgttcccaaggatcggtttaatactgaattaagatat
gccatgcaaaaaattttggcagacagttttaatgctgaagagattaccttttctactcag
ttttcggaatcggtattggcaagaattcattttatagtaagggttaatcccaaaaattta
cccgattttgatttaaaagaaatagagcaaaaattgattgaagtggggcggtcgtggatt
gatgatttgcaacatcatttacatgaagtctatggcgaagaacaagccaatgcactttac
tcccggtataaaaatgcgtttccaatatcttattctgataccttttcaccaagaacggct
gtctatgatattaagcatattgaaatgctaagccctgaaaatccactcggtattaatttc
tataagccattggatgaatctgagaaaagctttaggttaaaggtttatcagcatgacacc
actattcctttgtctgatgtactacctatcctggaaaaacttggtttaagagcaattagt
gaacgtccttatgttttaaaatttgaagatggtaaagtagcatggattaatgattttgcc
atgcaatacaacaaagaaagcgagtttaatatcgacgaaataaaagagttatttcaaaat
gcatttgccagggtatggtttggtgatgcagaaaatgatggctttaatttattggtatta
gcggccggattaaattggagggaagttgctgtattaagaacctatgcaaaatatttcagg
caaatagggtttacatttagccaggattatatggaaacagcactaaataataatgtaggc
attgccaagaaattagttaggttatttgaaattcggtgcaatccccatgactccaaaagg
agagaggatagatacgttgcacttgtcgctgaaattttatctgatcttgataatgtagct
aatctggatgaagacagaattataagacaatacgtgcatgccatcggtgccactcttcgt
accaatttttatcaagtagacgctcaaggtaatcctaagaattatatttctataaaattg
tccagcaaactcattcctggtgtaccaaaaccataccccatgtttgaaatttttgtttac
tcgccacgatttgaaggggtgcatttgcgctgtggtaaagtggctcgcggaggtttacgc
tggtcggacagacgtgaagatttccgaaccgaaattcttggcttaatgaaggctcaacag
gtaaagaactctgtaattgtccccagtggcgcgaaaggtggttttgtacccaaacagata
ccggctaatgctactcgtgaagaaattatggaggagggaatcagctgttataaactcttt
ataagaggtttgctggatataacagacaattacaaagaaggactcattgtaaaaccccaa
aatgttgttttttatgatgaagatgacccttatcttgtggtcgctgcagacaaaggcact
gcgacattttctgatattgccaattcaatttcccaagaatatgatttttggcttggagat
gcttttgcctcaggtggctctgttggttatgatcataaaaaaatggggattactgctaaa
ggggcatgggaatctgttaaacgccatttctatgaattgaacagagatatccaaaacaat
gatttcactgtggttggcataggagatatggccggggatgtctttggaaatggcatgttg
ttgtccaggcatatcaaactcgtaggtgcttttaatcatattcatatatttgtagaccct
aatcctgaagctgaagctagctttaaagagcgtgagcgattattcaatcttcccagatct
aactggacagactatgataaaaaactcatttccaaaggaggaggggttttttctcgtagt
gcaaaatctatcccggttagccctgaaatgcagaaagtatttggaataaaacaaacttcg
attgaacctaatgatctaattaaagcaatattaaaagccgatgtggatttactttggagt
gctggaattggaacctatgtcaaatcgagtactgaaagtaataccagcgtaggagatcga
acaaacgatgcaactcgtgttaatgccaatcagttgagatgcaaagttataggcgaaggt
gggaatttgggattaacccagctagcacgagtggagtatagtttacacggaggcaaagtc
tatacagatttcatagataattctggtggggttaattgctcagacaaagaagttaatatt
aagattttattgaataatgttgtatcagctggggatctgactccaaaacaaagaaatgag
cttttaagtaatatgactgatgaagtagccaaattagtgcttagagataatttcctacaa
acccgagccattagcctaactgcttctcaagccttaagagccattgaattacatgcaaga
tatattaacgaactagaaaaaacaggaaaaattgacagaactttagagtttttacctgat
gaaaaagtgctaatggaacacaaactaatggggaaaggattaactcaacctggaattgct
gttttaatgtgctacagcaaaaccatcttaaaagagcaagttcttgcttctgaagttcct
gaagaagattatatgaaccaaatacttattggttcatttcccaaacctctgcaagagcgt
tttagtaaacaaatgcaagatcatcccttaagaagagagataattgctacccgtttaagt
aacattattgttaatgaaatgggcttcacgtatgtttacaggttacaagatgaaactggg
gcatctgttgcggcaattgtcagggcctatatgattgctagaagtgtcttgaatctggaa
gcaatatggaagcaaattgaggaacttggtacaaaaatcagcgcgcaagctcaagttgat
atgatgatgctgtatgttcgactatccaggagagtgacaaggtggtttttacggacacat
agaaggtcgatgagtataacgcaggcgatagagttatacgcaaaaggggttgatgaactg
aaaaaatccatgcctgccgtttttggcgaaacaggccggattcaatatgaggagcattac
caagagcggataaaagaagggataccgcctcaacttgcccatgaattaacagtgactcga
ggcttgtttgccgcaacagacattatagaaattgcctacgaggaaaatataaaaatatca
aaagtagctgaaatatattttggtattggcgaatttcttgatatagcttggcttagaacc
caaattattgttcacacaactgaaaatcattgggaatctttatctcgagaggcattacgc
gatgatttggattggcaacaacgccagttaacagctgccataatgggttttgagcctaat
aataaggatttgcaagaacgattaacaagatggggagagacacacgtttctttaattgac
aggtggaattacattctgacagctctgaaatcaagtacagctttgaactatactatgttt
ttagttgccacccgagagttgctggatttaacccaaacgacattacaatccaatttaaaa
atggaagagtcattttga

DBGET integrated database retrieval system