KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_1718Help
Entry
LPV_1718          CDS       T02174                                 

Definition
(GenBank) NAD-glutamate dehydrogenase
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
lph00220  Arginine biosynthesis
lph00250  Alanine, aspartate and glutamate metabolism
lph00430  Taurine and hypotaurine metabolism
lph00910  Nitrogen metabolism
lph01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    LPV_1718
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPV_1718
   00220 Arginine biosynthesis
    LPV_1718
  Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LPV_1718
Enzymes [BR:lph01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     LPV_1718
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_GDH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: CCD08862
Position
complement(1741537..1746414)
Genome map
AA seq 1625 aa AA seqDB search
MSYKFEEGKDAIVKSVVEKIKQAMTGEQTEFCAEFAKQFYGTVALEDLLEWEVDDLYGAA
VNFWSLICERAPHETKIRIYNPDYERHGWQTTHTVVEVICEDMPFIVDSLRIVINRMGLT
SHLTIHMGGIRVKRDSHNRVTEILPRNGGAAKDDVLHEAPIFIEIDRQTDPATLSELHKN
FERALEDNRAVFEDWDKMRTKVREIIKELDTVPKTIDISEIEETKAFLNWMEDHHFTFLG
LRDYDLIKKGKETILQPIPETGLGVLRQSLSKSNARSITAMGPEAQGLISSPRILVMSKT
NTLASVHRDAYTDYIGVKRFNKKGEVIGERRIIGLYTSAAYHTNPKHIPFLRHKVALIMK
NSNLNPYSHAGKVLLNILETLPRDDLIQGTEDELLEIAMGIFYMQDRKRIRLFARADVYK
RFISCLVYVPKDRFNTELRYAMQKILADSFNAEEITFSTQFSESVLARIHFIVRVNPKNL
PDFDLKEIEQKLIEVGRSWIDDLQHHLHEVYGEEQANALYSRYKNAFPISYSDTFSPRTA
VYDIKHIEMLSPENPLGINFYKPLDESEKSFRLKVYQHDTTIPLSDVLPILEKLGLRAIS
ERPYVLKFEDGKVAWINDFAMQYNKESEFNIDEIKELFQNAFARVWFGDAENDGFNLLVL
AAGLNWREVAVLRTYAKYFRQIGFTFSQDYMETALNNNVGIAKKLVRLFEIRCNPHDSKR
REDRYVALVAEILSDLDNVANLDEDRIIRQYVHAIGATLRTNFYQVDAQGNPKNYISIKL
SSKLIPGVPKPYPMFEIFVYSPRFEGVHLRCGKVARGGLRWSDRREDFRTEILGLMKAQQ
VKNSVIVPSGAKGGFVPKQIPANATREEIMEEGISCYKLFIRGLLDITDNYKEGLIVKPQ
NVVFYDEDDPYLVVAADKGTATFSDIANSISQEYDFWLGDAFASGGSVGYDHKKMGITAK
GAWESVKRHFYELNRDIQNNDFTVVGIGDMAGDVFGNGMLLSRHIKLVGAFNHIHIFVDP
NPEAEASFKERERLFNLPRSNWTDYDKKLISKGGGVFSRSAKSIPVSPEMQKVFGIKQTS
IEPNDLIKAILKADVDLLWSAGIGTYVKSSTESNTSVGDRTNDATRVNANQLRCKVIGEG
GNLGLTQLARVEYSLHGGKVYTDFIDNSGGVNCSDKEVNIKILLNNVVSAGDLTPKQRNE
LLSNMTDEVAKLVLRDNFLQTRAISLTASQALRAIELHARYINELEKTGKIDRTLEFLPD
EKVLMEHKLMGKGLTQPGIAVLMCYSKTILKEQVLASEVPEEDYMNQILIGSFPKPLQER
FSKQMQDHPLRREIIATRLSNIIVNEMGFTYVYRLQDETGASVAAIVRAYMIARSVLNLE
AIWKQIEELGTKISAQAQVDMMMLYVRLSRRVTRWFLRTHRRSMSITQAIELYAKGVDEL
KKSMPAVFGETGRIQYEEHYQERIKEGIPPQLAHELTVTRGLFAATDIIEIAYEENIKIS
KVAEIYFGIGEFLDIAWLRTQIIVHTTENHWESLSREALRDDLDWQQRQLTAAIMGFEPN
NKDLQERLTRWGETHVSLIDRWNYILTALKSSTALNYTMFLVATRELLDLTQTTLQSNLK
MEESF
NT seq 4878 nt NT seq  +upstreamnt  +downstreamnt
atgtcctataaatttgaagaaggtaaagacgcaatagtaaaaagcgttgttgaaaaaatt
aagcaagcaatgactggcgaacaaacagagttttgcgctgaattcgcgaagcaattttat
gggactgtcgcccttgaagatcttctagagtgggaggttgatgatctttatggagcagca
gtcaatttctggtctttgatttgtgaacgtgctccacacgaaacaaaaatcaggatttat
aatcctgattatgaacgtcatggatggcaaaccacacatactgttgtggaagttatctgt
gaagatatgccttttattgtagattctctgaggatagtaattaatcgaatgggattaaca
tctcatcttactattcatatgggaggaattagggttaaaagagacagccataacagggtt
accgaaattcttccaagaaatggtggagctgctaaagatgatgttttacatgaggctccc
atttttatagaaattgatcgacaaacagacccggctaccttatcggagctgcacaaaaat
tttgaacgcgctcttgaggacaatcgagcggtatttgaagattgggataaaatgcgtact
aaagtacgagaaattattaaggagcttgatactgtaccaaagacaattgatatcagtgaa
attgaagagacgaaagcctttttaaattggatggaagatcaccattttacttttttagga
ttgcgagattatgatttgattaaaaaaggaaaagaaaccattttacaacctattcctgaa
acaggattgggagttttacgccaaagtctgagcaaatcaaatgcaagaagtattacggca
atgggaccagaggcacaaggattaatttcatcaccccgcattcttgtcatgtccaaaaca
aatactttagcctctgttcatagagatgcttataccgactatattggtgttaagcgcttc
aataaaaaaggagaggtgattggcgaaaggcgtattataggactgtatacttctgcagct
tatcatacaaatcccaagcatattccgtttttgcgacataaagtcgcattaattatgaaa
aattctaatttaaatccctatagccatgcaggtaaagtattattgaatatacttgaaact
cttccaagagatgatttaattcaaggcactgaggatgagttactggaaatagctatgggt
attttctatatgcaagatagaaaacgtatccgcctgtttgccagagccgatgtttacaag
cgatttatttcatgcttggtatatgttcccaaggatcggtttaatactgaattaagatat
gccatgcaaaaaattttggcagacagttttaatgctgaagagattaccttttctactcag
ttttcggaatcggtattggcaagaattcattttatagtaagggttaatcccaaaaattta
cccgattttgatttaaaagaaatagagcaaaaattgattgaagtggggcggtcgtggatt
gatgatttgcaacatcatttacatgaagtctatggcgaagaacaagccaatgcactttac
tcccggtataaaaatgcgtttccaatatcttattctgataccttttcaccaagaacggct
gtctatgatattaagcatattgaaatgctaagccctgaaaatccactcggtattaatttc
tataagccattggatgaatctgagaaaagctttaggttaaaggtttatcagcatgacacc
actattcctttgtctgatgtactacctatcctggaaaaacttggtttaagagcaattagt
gaacgtccttatgttttaaaatttgaagatggtaaagtagcatggattaatgattttgcc
atgcaatacaacaaagaaagcgagtttaatatcgacgaaataaaagagttatttcaaaat
gcatttgccagggtatggtttggtgatgcagaaaatgatggctttaatttattggtatta
gcggccggattaaattggagggaagttgctgtattaagaacctatgcaaaatatttcagg
caaatagggtttacatttagccaggattatatggaaacagcactaaataataatgtaggc
attgccaagaaattagttaggttatttgaaattcggtgcaatccccatgactccaaaagg
agagaggatagatacgttgcacttgtcgctgaaattttatctgatcttgataatgtagct
aatctggatgaagacagaattataagacaatacgtgcatgccatcggtgccactcttcgt
accaatttttatcaagtagacgctcaaggtaatcctaagaattatatttctataaaattg
tccagcaaactcattcctggtgtaccaaaaccataccccatgtttgaaatttttgtttac
tcgccacgatttgaaggggtgcatttgcgctgtggtaaagtggctcgcggaggtttacgc
tggtcggacagacgtgaagatttccgaaccgaaattcttggcttaatgaaggctcaacag
gtaaagaactctgtaattgtccccagtggcgcgaaaggtggttttgtacccaaacagata
ccggctaatgctactcgtgaagaaattatggaggagggaatcagctgttataaactcttt
ataagaggtttgctggatataacagacaattacaaagaaggactcattgtaaaaccccaa
aatgttgttttttatgatgaagatgacccttatcttgtggtcgctgcagacaaaggcact
gcgacattttctgatattgccaattcaatttcccaagaatatgatttttggcttggagat
gcttttgcctcaggtggctctgttggttatgatcataaaaaaatggggattactgctaaa
ggggcatgggaatctgttaaacgccatttctatgaattgaacagagatatccaaaacaat
gatttcactgtggttggcataggagatatggccggggatgtctttggaaatggcatgttg
ttgtccaggcatatcaaactcgtaggtgcttttaatcatattcatatatttgtagaccct
aatcctgaagctgaagctagctttaaagagcgtgagcgattattcaatcttcccagatct
aactggacagactatgataaaaaactcatttccaaaggaggaggggttttttctcgtagt
gcaaaatctatcccggttagccctgaaatgcagaaagtatttggaataaaacaaacttcg
attgaacctaatgatctaattaaagcaatattaaaagccgatgtggatttactttggagt
gctggaattggaacctatgtcaaatcgagtactgaaagtaataccagcgtaggagatcga
acaaacgatgcaactcgtgttaatgccaatcagttgagatgcaaagttataggcgaaggt
gggaatttgggattaacccagctagcacgagtggagtatagtttacacggaggcaaagtc
tatacagatttcatagataattctggtggggttaattgctcagacaaagaagttaatatt
aagattttattgaataatgttgtatcagctggggatctgactccaaaacaaagaaatgag
cttttaagtaatatgactgatgaagtagccaaattagtgcttagagataatttcctacaa
acccgagccattagcctaactgcttctcaagccttaagagccattgaattacatgcaaga
tatattaacgaactagaaaaaacaggaaaaattgacagaactttagagtttttacctgat
gaaaaagtgctaatggaacacaaactaatggggaaaggattaactcaacctggaattgct
gttttaatgtgctacagcaaaaccatcttaaaagagcaagttcttgcttctgaagttcct
gaagaagattatatgaaccaaatacttattggttcatttcccaaacctctgcaagagcgt
tttagtaaacaaatgcaagatcatcccttaagaagagagataattgctacccgtttaagt
aacattattgttaatgaaatgggcttcacgtatgtttacaggttacaagatgaaactggg
gcatctgttgcggcaattgtcagggcctatatgattgctagaagtgtcttgaatctggaa
gcaatatggaagcaaattgaggaacttggtacaaaaatcagcgcgcaagctcaagttgat
atgatgatgctgtatgttcgactatccaggagagtgacaaggtggtttttacggacacat
agaaggtcgatgagtataacgcaggcgatagagttatacgcaaaaggggttgatgaactg
aaaaaatccatgcctgccgtttttggcgaaacaggccggattcaatatgaggagcattac
caagagcggataaaagaagggataccgcctcaacttgcccatgaattaacagtgactcga
ggcttgtttgccgcaacagacattatagaaattgcctacgaggaaaatataaaaatatca
aaagtagctgaaatatattttggtattggcgaatttcttgatatagcttggcttagaacc
caaattattgttcacacaactgaaaatcattgggaatctttatctcgagaggcattacgc
gatgatttggattggcaacaacgccagttaacagctgccataatgggttttgagcctaat
aataaggatttgcaagaacgattaacaagatggggagagacacacgtttctttaattgac
aggtggaattacattctgacagctctgaaatcaagtacagctttgaactatactatgttt
ttagttgccacccgagagttgctggatttaacccaaacgacattacaatccaatttaaaa
atggaagagtcattttga

DBGET integrated database retrieval system