KEGG   Legionella pneumophila subsp. pneumophila HL06041035: LPV_1807Help
Entry
LPV_1807          CDS       T02174                                 

Definition
putative thymidine phosphorylase (TdRPase) (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
lph  Legionella pneumophila subsp. pneumophila HL06041035
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lph00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    LPV_1807
Enzymes [BR:lph01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     LPV_1807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1827309..1828823)
Genome map
AA seq 504 aa AA seqDB search
MSKKTPHGLRLKHLGIKTYHEAIIYMREDCHVCHSEGFEVQTRIQVTLGSRSIIATLNVV
TSELLAPGEAGLSDYAWDSLQAKEGDEIQVSHPKPLESLSYVHTKIYGNELSFEQMKVII
DDVLSGRLSDVQISAFLAASSAGRLTSTEIMKLTKAMIDSGERLSWPSHLIVDKHCVGGL
PGNRTTLIVVPIVAAFGLMIPKTSSRAITSPAGTADTMETLAPVHLSSKKMRQVVEQENG
CIVWGGAVSLSPADDVLIRVERAIDLDSEGQLVASILSKKIATGATHAVIDIPVGPTAKV
RNQSMALLLKQLLEEVGQQLGLVVHTVLTDGSQPVGNGIGPSLEARDVLSVLQGLPDAPN
DLRERALTLAGAALEFSSQVQPGLGKSIAKQLLDSGQAFKKFQAICEAQGGMRELTKARF
THPVVAAKAGQVALIDNRKLAKLAKLAGAPQSKSAGIDLHVHVGKAVEQGEPLFTIHSES
SGELHYACEFLRDKQDVIVLGEHS
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaagaaaacccctcatgggcttcgtttaaagcatttagggattaaaacctatcat
gaggccattatttacatgcgcgaggattgccatgtctgtcactcggaaggatttgaagta
cagactcgtatccaagtgactttaggtagccgctccattatagccacccttaatgtggtg
acctcagagcttctagcaccaggggaggcgggtttgtcagattatgcctgggattcgtta
caggccaaagaaggcgatgaaattcaagtttcccaccctaagcccttggaatctttaagt
tatgtgcataccaagatttatggcaatgaactgtcttttgaacaaatgaaggtcattatt
gatgatgtgttaagcggccgactttctgatgtgcaaatttcggcttttctcgcggcaagt
agcgcaggacggctaaccagtacggaaatcatgaaactcaccaaagccatgattgatagt
ggtgaacgtttatcctggccttcgcatcttattgtggataaacattgcgtgggaggattg
ccgggaaatcgcacgacgctgattgtggttcctatcgtggctgcttttggattgatgatt
ccaaaaacatcatcgcgtgccattacgtctcctgcggggacggcggacaccatggagact
ttggctcctgttcacttaagctctaaaaagatgcgccaagtggttgagcaagaaaatggc
tgcattgtgtggggtggggctgtgagtttaagtcctgctgatgacgtgctcattcgagtg
gaacgagccatcgatttagatagtgaagggcaattagtggcttccattctttctaaaaaa
attgcaacgggtgctacgcatgcggtcattgatattcccgtggggcctactgccaaagtc
cggaatcagtctatggcgctccttctgaaacaattgcttgaggaggtgggacaacagtta
gggcttgtggtccatacggtattgacggatgggtcgcaaccggtgggaaacggcattggt
ccgtcgttagaagcccgtgatgttctttccgtattgcaagggttgcctgatgcgcccaat
gatttacgcgaacgagcgttgactcttgcaggtgcagcgcttgagttttcttcgcaagta
caacctggattagggaaatccattgcaaagcaattattggatagcggacaagcttttaag
aaatttcaggccatttgtgaggctcagggtgggatgagggaattgaccaaggcgcgtttt
actcatcctgttgtggccgcaaaagcaggacaagtcgctctcattgataatcgaaaactt
gccaaactcgctaagctagctggtgcgcctcaatcgaaatcggctggtattgaccttcat
gttcatgtgggtaaagctgtggaacaaggcgagcctttgtttacgattcattcagagtct
tcaggggagcttcattacgcctgtgagtttctgcgtgacaaacaagacgtcattgtttta
ggagaacactcttga

DBGET integrated database retrieval system